Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-DnaT
Location 36251..36773 Replicon plasmid unnamed2
Accession NZ_CP122498
Organism Escherichia coli strain a7

Toxin (Protein)


Gene name relE Uniprot ID G3CAN5
Locus tag QC805_RS23330 Protein ID WP_000220560.1
Coordinates 36492..36773 (+) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID G3CAG1
Locus tag QC805_RS23325 Protein ID WP_000121743.1
Coordinates 36251..36502 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QC805_RS23295 31614..31844 + 231 WP_000051064.1 plasmid partition protein ParG -
QC805_RS23300 31860..32153 + 294 WP_015060510.1 hypothetical protein -
QC805_RS23305 32155..33123 + 969 WP_077249520.1 IS5-like element IS903B family transposase -
QC805_RS23310 33183..33536 - 354 WP_000876434.1 DNA distortion polypeptide 3 -
QC805_RS23315 33673..34119 - 447 WP_001074386.1 hypothetical protein -
QC805_RS23320 34159..34995 - 837 WP_001050931.1 RepB family plasmid replication initiator protein -
QC805_RS23325 36251..36502 + 252 WP_000121743.1 plasmid stabilization protein Antitoxin
QC805_RS23330 36492..36773 + 282 WP_000220560.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QC805_RS23335 36919..37242 + 324 WP_001181903.1 hypothetical protein -
QC805_RS23340 37287..37532 + 246 WP_000356546.1 hypothetical protein -
QC805_RS23345 37522..37737 + 216 WP_001180116.1 hypothetical protein -
QC805_RS23350 37830..38159 + 330 WP_000866648.1 hypothetical protein -
QC805_RS23355 38446..38595 + 150 WP_000003880.1 hypothetical protein -
QC805_RS23360 38608..38880 + 273 WP_000160399.1 hypothetical protein -
QC805_RS23365 39207..39752 + 546 WP_038976855.1 DNA distortion polypeptide 1 -
QC805_RS23370 39755..40912 + 1158 WP_000538023.1 DNA distortion polypeptide 2 -
QC805_RS23375 41273..41764 + 492 WP_000872475.1 transcription termination/antitermination NusG family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid aph(3')-Ia / blaCTX-M-55 / qnrS1 / tet(A) - 1..46710 46710


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 11005.83 Da        Isoelectric Point: 10.5938

>T277043 WP_000220560.1 NZ_CP122498:36492-36773 [Escherichia coli]
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADLR

Download         Length: 282 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9194.43 Da        Isoelectric Point: 4.1683

>AT277043 WP_000121743.1 NZ_CP122498:36251-36502 [Escherichia coli]
MSYQILTTTAASITDLKKNPMGTVAEGEGDAVAILNRNEPAFYCVPPKLYAYYRELAEDAELNAVADERMKNPEIVKVNL
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G3CAN5

Antitoxin

Source ID Structure
AlphaFold DB A0A3S5I301

References