Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | ataT-KacA/DUF1778(antitoxin) |
Location | 30316..31114 | Replicon | plasmid unnamed1 |
Accession | NZ_CP122497 | ||
Organism | Escherichia coli strain a7 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | - |
Locus tag | QC805_RS22700 | Protein ID | WP_072662620.1 |
Coordinates | 30316..30837 (-) | Length | 174 a.a. |
Antitoxin (Protein)
Gene name | KacA | Uniprot ID | A0A141BRA2 |
Locus tag | QC805_RS22705 | Protein ID | WP_001711191.1 |
Coordinates | 30845..31114 (-) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QC805_RS22675 | 25435..28149 | + | 2715 | WP_250147488.1 | tail fiber protein | - |
QC805_RS22680 | 28149..28730 | + | 582 | WP_087904721.1 | tail fiber assembly protein | - |
QC805_RS22685 | 28864..29187 | + | 324 | WP_001711185.1 | hypothetical protein | - |
QC805_RS22690 | 29201..29893 | + | 693 | WP_024172707.1 | membrane protein | - |
QC805_RS22695 | 29896..30147 | + | 252 | WP_023135660.1 | hypothetical protein | - |
QC805_RS22700 | 30316..30837 | - | 522 | WP_072662620.1 | GNAT family N-acetyltransferase | Toxin |
QC805_RS22705 | 30845..31114 | - | 270 | WP_001711191.1 | DUF1778 domain-containing protein | Antitoxin |
QC805_RS22710 | 31434..32102 | + | 669 | WP_000161228.1 | division plane positioning ATPase MipZ | - |
QC805_RS22715 | 32108..32461 | + | 354 | WP_160378290.1 | hypothetical protein | - |
QC805_RS22720 | 32514..33281 | - | 768 | WP_033870691.1 | hypothetical protein | - |
QC805_RS22725 | 33564..34289 | + | 726 | WP_087904723.1 | hypothetical protein | - |
QC805_RS22730 | 34350..35690 | + | 1341 | WP_023135655.1 | DnaB-like helicase C-terminal domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..107494 | 107494 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 174 a.a. Molecular weight: 19359.18 Da Isoelectric Point: 8.2462
>T277041 WP_072662620.1 NZ_CP122497:c30837-30316 [Escherichia coli]
VSNTTIEIFSGEKDYDLNGFDCGEESLNAFLTNHLKRQHEGKILRAYVLCTKEEIPKVLGYYTLSGSCFEKETLPSKSQQ
KKVPYRNVPSITLGRLALDKSLQGQGLGSMLVTHAMRVVYNASLAVGIHGLFVEALNDKARAFYKSLGFIQLVGNNDRSL
FYPTKSIEKLFEE
VSNTTIEIFSGEKDYDLNGFDCGEESLNAFLTNHLKRQHEGKILRAYVLCTKEEIPKVLGYYTLSGSCFEKETLPSKSQQ
KKVPYRNVPSITLGRLALDKSLQGQGLGSMLVTHAMRVVYNASLAVGIHGLFVEALNDKARAFYKSLGFIQLVGNNDRSL
FYPTKSIEKLFEE
Download Length: 522 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|