Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
Location | 4010429..4011024 | Replicon | chromosome |
Accession | NZ_CP122496 | ||
Organism | Escherichia coli strain a7 |
Toxin (Protein)
Gene name | chpB | Uniprot ID | A0A827ISR3 |
Locus tag | QC805_RS19885 | Protein ID | WP_061359519.1 |
Coordinates | 4010429..4010779 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | chpS | Uniprot ID | A0A240D6C8 |
Locus tag | QC805_RS19890 | Protein ID | WP_001223212.1 |
Coordinates | 4010773..4011024 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QC805_RS19865 (4005878) | 4005878..4006900 | - | 1023 | WP_001301928.1 | ABC transporter permease | - |
QC805_RS19870 (4006914) | 4006914..4008416 | - | 1503 | WP_000205807.1 | sugar ABC transporter ATP-binding protein | - |
QC805_RS19875 (4008556) | 4008556..4009512 | - | 957 | WP_284613972.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
QC805_RS19880 (4009822) | 4009822..4010352 | + | 531 | WP_000055070.1 | inorganic diphosphatase | - |
QC805_RS19885 (4010429) | 4010429..4010779 | - | 351 | WP_061359519.1 | endoribonuclease toxin ChpB | Toxin |
QC805_RS19890 (4010773) | 4010773..4011024 | - | 252 | WP_001223212.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
QC805_RS19895 (4011236) | 4011236..4011577 | - | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
QC805_RS19900 (4011580) | 4011580..4015359 | - | 3780 | WP_061359518.1 | autotransporter assembly complex protein TamB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12506.43 Da Isoelectric Point: 6.4786
>T277039 WP_061359519.1 NZ_CP122496:c4010779-4010429 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLHARQAKRIGLAADEVVEEALLRLQAVVK
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLHARQAKRIGLAADEVVEEALLRLQAVVK
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A827ISR3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A240D6C8 |