Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2319712..2320350 | Replicon | chromosome |
Accession | NZ_CP122496 | ||
Organism | Escherichia coli strain a7 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | QC805_RS11290 | Protein ID | WP_000813794.1 |
Coordinates | 2320174..2320350 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | QC805_RS11285 | Protein ID | WP_001270286.1 |
Coordinates | 2319712..2320128 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QC805_RS11265 (2314864) | 2314864..2315805 | - | 942 | WP_001251313.1 | ABC transporter permease | - |
QC805_RS11270 (2315806) | 2315806..2316819 | - | 1014 | WP_000220399.1 | ABC transporter ATP-binding protein | - |
QC805_RS11275 (2316837) | 2316837..2317982 | - | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
QC805_RS11280 (2318227) | 2318227..2319633 | - | 1407 | WP_284613874.1 | PLP-dependent aminotransferase family protein | - |
QC805_RS11285 (2319712) | 2319712..2320128 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
QC805_RS11290 (2320174) | 2320174..2320350 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
QC805_RS11295 (2320572) | 2320572..2320802 | + | 231 | WP_000494244.1 | YncJ family protein | - |
QC805_RS11300 (2320894) | 2320894..2322855 | - | 1962 | WP_284614154.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
QC805_RS11305 (2322928) | 2322928..2323464 | - | 537 | WP_000429133.1 | DNA-binding transcriptional regulator SutR | - |
QC805_RS11310 (2323556) | 2323556..2324731 | + | 1176 | WP_001236251.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 2324771..2326036 | 1265 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T277035 WP_000813794.1 NZ_CP122496:c2320350-2320174 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT277035 WP_001270286.1 NZ_CP122496:c2320128-2319712 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|