Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 17674..18275 Replicon plasmid unnamed2
Accession NZ_CP122494
Organism Escherichia coli strain a15

Toxin (Protein)


Gene name doc Uniprot ID U9YA20
Locus tag QC807_RS25115 Protein ID WP_001216045.1
Coordinates 17895..18275 (+) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag QC807_RS25110 Protein ID WP_001190712.1
Coordinates 17674..17895 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QC807_RS25060 13190..13777 + 588 WP_042198327.1 hypothetical protein -
QC807_RS25065 13764..14444 + 681 WP_219386288.1 ead/Ea22-like family protein -
QC807_RS25070 14441..15007 + 567 WP_124053539.1 ead/Ea22-like family protein -
QC807_RS25075 15009..15200 + 192 WP_108997177.1 hypothetical protein -
QC807_RS25080 15203..15328 + 126 Protein_20 hypothetical protein -
QC807_RS25085 15329..16201 + 873 WP_225893138.1 hypothetical protein -
QC807_RS25090 16185..16469 + 285 WP_001142394.1 hypothetical protein -
QC807_RS25095 16454..16804 - 351 WP_000551789.1 hypothetical protein -
QC807_RS25100 16837..17088 + 252 WP_001283837.1 DNA polymerase III subunit theta -
QC807_RS25105 17212..17601 + 390 WP_000506726.1 S24 family peptidase -
QC807_RS25110 17674..17895 + 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QC807_RS25115 17895..18275 + 381 WP_001216045.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
QC807_RS25120 18280..18459 + 180 WP_000113019.1 hypothetical protein -
QC807_RS25125 18487..19531 + 1045 Protein_29 DUF968 domain-containing protein -
QC807_RS25130 19620..20072 + 453 WP_001312282.1 late promoter-activating protein (Gp10) -
QC807_RS25135 20159..21352 + 1194 WP_000219608.1 hypothetical protein -
QC807_RS25140 21394..22836 + 1443 WP_001472843.1 hypothetical protein -
QC807_RS25145 22920..23150 + 231 Protein_33 ash family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..99442 99442


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(3-120)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13588.29 Da        Isoelectric Point: 5.1514

>T277021 WP_001216045.1 NZ_CP122494:17895-18275 [Escherichia coli]
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT277021 WP_001190712.1 NZ_CP122494:17674-17895 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CLP7

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References