Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 91865..92400 Replicon plasmid unnamed1
Accession NZ_CP122493
Organism Escherichia coli strain a15

Toxin (Protein)


Gene name relE Uniprot ID V0VJJ7
Locus tag QC807_RS24355 Protein ID WP_000222760.1
Coordinates 92113..92400 (+) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID V0VIP2
Locus tag QC807_RS24350 Protein ID WP_001132900.1
Coordinates 91865..92116 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QC807_RS24315 (87445) 87445..87657 + 213 WP_253179989.1 hypothetical protein -
QC807_RS24320 (87899) 87899..88360 + 462 WP_001233868.1 thermonuclease family protein -
QC807_RS24325 (88406) 88406..88614 + 209 Protein_104 hemolysin expression modulator Hha -
QC807_RS24330 (88653) 88653..89243 + 591 WP_000766814.1 DUF2726 domain-containing protein -
QC807_RS24335 (89483) 89483..89737 + 255 WP_000083830.1 replication regulatory protein RepA -
QC807_RS24340 (89975) 89975..90049 + 75 WP_001365705.1 RepA leader peptide Tap -
QC807_RS24345 (90042) 90042..90899 + 858 WP_042047880.1 incFII family plasmid replication initiator RepA -
QC807_RS24350 (91865) 91865..92116 + 252 WP_001132900.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QC807_RS24355 (92113) 92113..92400 + 288 WP_000222760.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QC807_RS24360 (92504) 92504..92824 + 321 Protein_111 serine acetyltransferase -
QC807_RS24365 (92840) 92840..93187 - 348 Protein_112 IS1-like element IS1A family transposase -
QC807_RS24370 (93276) 93276..94298 + 1023 WP_000255956.1 IS21-like element IS100 family transposase -
QC807_RS24375 (94295) 94295..95077 + 783 WP_072837579.1 IS21-like element IS100kyp family helper ATPase IstB -
QC807_RS24380 (95132) 95132..95496 - 365 Protein_115 IS1 family transposase -
QC807_RS24385 (95596) 95596..96817 + 1222 Protein_116 ISL3 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sitABCD / tet(A) / blaTEM-1B iucA / iucB / iucC / iucD / iutA / afaC-I 1..207405 207405


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-83)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11105.15 Da        Isoelectric Point: 10.5832

>T277018 WP_000222760.1 NZ_CP122493:92113-92400 [Escherichia coli]
MTYTVKFRDDALKEWLKLDKSIQQQFAKKLKKCSENPHIPSAKLRGLKDCYKIKLRASGFRLVYQVIDDMLIIAVVAVGK
RERSNVYNLASERMR

Download         Length: 288 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9211.41 Da        Isoelectric Point: 4.0780

>AT277018 WP_001132900.1 NZ_CP122493:91865-92116 [Escherichia coli]
MPNIILSDTSASVSELKKNPMATVSAGDGYPVAILNRNQPAFYCVPAELYERMLDALDDQELVKLVTERSNQPLHDVDLD
SYL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0VJJ7

Antitoxin

Source ID Structure
AlphaFold DB V0VIP2

References