Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | ypjF-yeeU/CbtA-CbeA |
| Location | 4261866..4262641 | Replicon | chromosome |
| Accession | NZ_CP122492 | ||
| Organism | Escherichia coli strain a15 | ||
Toxin (Protein)
| Gene name | ypjF | Uniprot ID | A0A7V7JG91 |
| Locus tag | QC807_RS20755 | Protein ID | WP_001193488.1 |
| Coordinates | 4261866..4262237 (-) | Length | 124 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A7V7JFU6 |
| Locus tag | QC807_RS20760 | Protein ID | WP_001059301.1 |
| Coordinates | 4262276..4262641 (-) | Length | 122 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QC807_RS20730 (4256948) | 4256948..4258054 | + | 1107 | WP_001044128.1 | N-acetylneuraminate epimerase | - |
| QC807_RS20735 (4258119) | 4258119..4259099 | + | 981 | WP_001366032.1 | sialate O-acetylesterase | - |
| QC807_RS20740 (4259107) | 4259107..4259211 | - | 105 | Protein_4061 | HNH endonuclease | - |
| QC807_RS20745 (4259311) | 4259311..4260183 | + | 873 | WP_000168567.1 | HNH endonuclease | - |
| QC807_RS20750 (4260294) | 4260294..4261292 | - | 999 | WP_001240355.1 | membrane protein | - |
| QC807_RS20755 (4261866) | 4261866..4262237 | - | 372 | WP_001193488.1 | TA system toxin CbtA family protein | Toxin |
| QC807_RS20760 (4262276) | 4262276..4262641 | - | 366 | WP_001059301.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QC807_RS20765 (4262667) | 4262667..4262888 | - | 222 | WP_000691983.1 | DUF987 domain-containing protein | - |
| QC807_RS20770 (4262885) | 4262885..4263427 | - | 543 | WP_015740440.1 | DNA repair protein RadC | - |
| QC807_RS20775 (4263440) | 4263440..4263883 | - | 444 | WP_001096016.1 | antirestriction protein | - |
| QC807_RS20780 (4263914) | 4263914..4264735 | - | 822 | WP_001234409.1 | DUF932 domain-containing protein | - |
| QC807_RS20785 (4264855) | 4264855..4265328 | - | 474 | WP_001298943.1 | hypothetical protein | - |
| QC807_RS20790 (4265400) | 4265400..4265852 | - | 453 | WP_000734321.1 | hypothetical protein | - |
| QC807_RS20795 (4265888) | 4265888..4266604 | - | 717 | WP_000174910.1 | WYL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | fimE / fimB | 4253081..4269381 | 16300 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13832.94 Da Isoelectric Point: 7.2419
>T277010 WP_001193488.1 NZ_CP122492:c4262237-4261866 [Escherichia coli]
MQTISSHPTRATQPCLSPVEIWQRLLTCLLSQHYGLTLNDTPFSNETTILEHIDAGVSLCDAVNFLVEKYELVRIDCNDC
SVMEKSPFITSIDILRARKASGLMKRNSHKTVTRVTAGRLQEL
MQTISSHPTRATQPCLSPVEIWQRLLTCLLSQHYGLTLNDTPFSNETTILEHIDAGVSLCDAVNFLVEKYELVRIDCNDC
SVMEKSPFITSIDILRARKASGLMKRNSHKTVTRVTAGRLQEL
Download Length: 372 bp
Antitoxin
Download Length: 122 a.a. Molecular weight: 13388.25 Da Isoelectric Point: 5.9530
>AT277010 WP_001059301.1 NZ_CP122492:c4262641-4262276 [Escherichia coli]
MNNHSESGTKPENPACQQWGLKCAITPCFGARLVQEGNRLHFLSDRAGFSGAFAVDVAMRLDQAFPLMMKQLELMLTSGE
LNPRHPHCVTLYHNGLTCEADTLGSCGYVYIAIYPEQTEPQ
MNNHSESGTKPENPACQQWGLKCAITPCFGARLVQEGNRLHFLSDRAGFSGAFAVDVAMRLDQAFPLMMKQLELMLTSGE
LNPRHPHCVTLYHNGLTCEADTLGSCGYVYIAIYPEQTEPQ
Download Length: 366 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7V7JG91 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7V7JFU6 |