Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 3557375..3558212 | Replicon | chromosome |
Accession | NZ_CP122492 | ||
Organism | Escherichia coli strain a15 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | Q3Z4X7 |
Locus tag | QC807_RS17260 | Protein ID | WP_000227784.1 |
Coordinates | 3557670..3558212 (+) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | I2UQS9 |
Locus tag | QC807_RS17255 | Protein ID | WP_001297137.1 |
Coordinates | 3557375..3557686 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QC807_RS17230 (3552395) | 3552395..3553342 | + | 948 | WP_001239441.1 | cytochrome o ubiquinol oxidase subunit II | - |
QC807_RS17235 (3553364) | 3553364..3555355 | + | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
QC807_RS17240 (3555345) | 3555345..3555959 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
QC807_RS17245 (3555959) | 3555959..3556288 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
QC807_RS17250 (3556300) | 3556300..3557190 | + | 891 | WP_000971336.1 | heme o synthase | - |
QC807_RS17255 (3557375) | 3557375..3557686 | + | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
QC807_RS17260 (3557670) | 3557670..3558212 | + | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
QC807_RS17265 (3558268) | 3558268..3559203 | - | 936 | WP_001297127.1 | tetratricopeptide repeat protein | - |
QC807_RS17270 (3559611) | 3559611..3560975 | + | 1365 | WP_001000975.1 | MFS transporter | - |
QC807_RS17275 (3561103) | 3561103..3561594 | - | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
QC807_RS17280 (3561762) | 3561762..3562673 | + | 912 | WP_000705877.1 | 2-dehydropantoate 2-reductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T277008 WP_000227784.1 NZ_CP122492:3557670-3558212 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|