Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 782326..783124 Replicon chromosome
Accession NZ_CP122492
Organism Escherichia coli strain a15

Toxin (Protein)


Gene name yeeV Uniprot ID -
Locus tag QC807_RS03810 Protein ID WP_072665353.1
Coordinates 782326..782700 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A3W5RLB4
Locus tag QC807_RS03815 Protein ID WP_041124172.1
Coordinates 782747..783124 (-) Length 126 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QC807_RS03775 (777475) 777475..778038 + 564 WP_001115140.1 type II secretion system minor pseudopilin GspH -
QC807_RS03780 (778035) 778035..778406 + 372 WP_000820125.1 type II secretion system minor pseudopilin GspI -
QC807_RS03785 (778403) 778403..779002 + 600 WP_001255040.1 type II secretion system minor pseudopilin GspJ -
QC807_RS03790 (779005) 779005..779982 + 978 WP_000633238.1 type II secretion system minor pseudopilin GspK -
QC807_RS03795 (779979) 779979..781157 + 1179 WP_000094971.1 type II secretion system protein GspL -
QC807_RS03800 (781159) 781159..781695 + 537 WP_000942795.1 GspM family type II secretion system protein YghD -
QC807_RS03805 (781976) 781976..782329 - 354 WP_071685956.1 DUF5983 family protein -
QC807_RS03810 (782326) 782326..782700 - 375 WP_072665353.1 TA system toxin CbtA family protein Toxin
QC807_RS03815 (782747) 782747..783124 - 378 WP_041124172.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
QC807_RS03820 (783200) 783200..783421 - 222 WP_000692307.1 DUF987 domain-containing protein -
QC807_RS03825 (783490) 783490..783966 - 477 WP_021559500.1 RadC family protein -
QC807_RS03830 (783982) 783982..784467 - 486 WP_041124170.1 antirestriction protein -
QC807_RS03835 (784559) 784559..785377 - 819 WP_001234621.1 DUF932 domain-containing protein -
QC807_RS03840 (785476) 785476..785709 - 234 WP_001278287.1 DUF905 family protein -
QC807_RS03845 (785715) 785715..786392 - 678 WP_021559490.1 hypothetical protein -
QC807_RS03850 (786543) 786543..787223 - 681 WP_001282912.1 WYL domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - papC / papD 782326..831209 48883


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 14063.00 Da        Isoelectric Point: 7.2920

>T276997 WP_072665353.1 NZ_CP122492:c782700-782326 [Escherichia coli]
MNTLPDTHVRETSGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR

Download         Length: 375 bp

Antitoxin


Download         Length: 126 a.a.        Molecular weight: 13752.57 Da        Isoelectric Point: 6.2021

>AT276997 WP_041124172.1 NZ_CP122492:c783124-782747 [Escherichia coli]
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRASIRGRFSDADAYHLDQAFPLLMKQLELMLTGG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAAPAITV

Download         Length: 378 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A3W5RLB4

References