Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 60981..61717 Replicon plasmid pBC16_IncFIBK
Accession NZ_CP122473
Organism Klebsiella pneumoniae subsp. pneumoniae strain IITJ_BC16

Toxin (Protein)


Gene name tacT Uniprot ID L7SZ15
Locus tag P9M40_RS28640 Protein ID WP_003026803.1
Coordinates 61235..61717 (+) Length 161 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID L7SZ29
Locus tag P9M40_RS28635 Protein ID WP_003026799.1
Coordinates 60981..61247 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P9M40_RS28590 (P9M40_28585) 57043..57405 - 363 WP_004152100.1 arsenite efflux transporter metallochaperone ArsD -
P9M40_RS28595 (P9M40_28590) 57455..57805 - 351 WP_004152101.1 As(III)-sensing metalloregulatory transcriptional repressor ArsR -
P9M40_RS28600 (P9M40_28595) 58163..58432 + 270 WP_004152102.1 hypothetical protein -
P9M40_RS28605 (P9M40_28600) 58420..58995 + 576 WP_004152103.1 hypothetical protein -
P9M40_RS28610 (P9M40_28605) 59026..59520 + 495 WP_004152104.1 DNA-binding protein -
P9M40_RS28615 (P9M40_28610) 59564..59932 + 369 WP_004152105.1 hypothetical protein -
P9M40_RS28620 (P9M40_28615) 59966..60169 + 204 WP_004152106.1 HHA domain-containing protein -
P9M40_RS28625 (P9M40_28620) 60218..60475 + 258 WP_004152107.1 hypothetical protein -
P9M40_RS28630 (P9M40_28625) 60551..60805 + 255 WP_004152108.1 hypothetical protein -
P9M40_RS28635 (P9M40_28630) 60981..61247 + 267 WP_003026799.1 DUF1778 domain-containing protein Antitoxin
P9M40_RS28640 (P9M40_28635) 61235..61717 + 483 WP_003026803.1 GNAT family N-acetyltransferase Toxin
P9M40_RS28645 (P9M40_28640) 61925..63271 + 1347 WP_077255522.1 ISNCY family transposase -
P9M40_RS28650 (P9M40_28645) 63320..63718 + 399 WP_032422684.1 helix-turn-helix domain-containing protein -
P9M40_RS28655 (P9M40_28650) 63914..65260 + 1347 WP_020314316.1 ISNCY family transposase -
P9M40_RS28660 (P9M40_28655) 65421..65552 + 132 WP_004218042.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..93587 93587


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(45-149)

Antitoxin

Vibrio phage ICP1, Orf50

(6-82)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17353.97 Da        Isoelectric Point: 9.5822

>T276993 WP_003026803.1 NZ_CP122473:61235-61717 [Klebsiella pneumoniae subsp. pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP

Download         Length: 483 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10147.59 Da        Isoelectric Point: 4.5256

>AT276993 WP_003026799.1 NZ_CP122473:60981-61247 [Klebsiella pneumoniae subsp. pneumoniae]
MKSDVQLNLRAKESQRALIDAAAEILHKSRTDFILEMACKAAENVILDRRVFNFNDEQYAEFIDMLDAPVEDEPAINKLL
ARKPQWDV

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0J2GNW6

Antitoxin

Source ID Structure
AlphaFold DB A0A1Q8YL66

References