Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 5226849..5227474 | Replicon | chromosome |
| Accession | NZ_CP122469 | ||
| Organism | Klebsiella pneumoniae subsp. pneumoniae strain IITJ_BC16 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | P9M40_RS25915 | Protein ID | WP_040182550.1 |
| Coordinates | 5226849..5227232 (-) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | J2DFR0 |
| Locus tag | P9M40_RS25920 | Protein ID | WP_004150355.1 |
| Coordinates | 5227232..5227474 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P9M40_RS25900 (5224215) | 5224215..5225117 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
| P9M40_RS25905 (5225114) | 5225114..5225749 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
| P9M40_RS25910 (5225746) | 5225746..5226675 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
| P9M40_RS25915 (5226849) | 5226849..5227232 | - | 384 | WP_040182550.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| P9M40_RS25920 (5227232) | 5227232..5227474 | - | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
| P9M40_RS25925 (5227679) | 5227679..5228596 | + | 918 | WP_023302328.1 | alpha/beta hydrolase | - |
| P9M40_RS25930 (5228610) | 5228610..5229551 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
| P9M40_RS25935 (5229596) | 5229596..5230033 | - | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
| P9M40_RS25940 (5230030) | 5230030..5230890 | - | 861 | WP_004146232.1 | virulence factor BrkB family protein | - |
| P9M40_RS25945 (5230884) | 5230884..5231483 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14376.67 Da Isoelectric Point: 9.5352
>T276989 WP_040182550.1 NZ_CP122469:c5227232-5226849 [Klebsiella pneumoniae subsp. pneumoniae]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLKLITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLKLITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|