Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4749007..4749523 | Replicon | chromosome |
| Accession | NZ_CP122469 | ||
| Organism | Klebsiella pneumoniae subsp. pneumoniae strain IITJ_BC16 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | J2XDK6 |
| Locus tag | P9M40_RS23655 | Protein ID | WP_002886902.1 |
| Coordinates | 4749007..4749291 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | R4Y888 |
| Locus tag | P9M40_RS23660 | Protein ID | WP_002886901.1 |
| Coordinates | 4749281..4749523 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P9M40_RS23630 (4744423) | 4744423..4744686 | - | 264 | WP_014908078.1 | PTS sugar transporter subunit IIB | - |
| P9M40_RS23635 (4744816) | 4744816..4744989 | + | 174 | WP_032410138.1 | hypothetical protein | - |
| P9M40_RS23640 (4744992) | 4744992..4745735 | + | 744 | WP_021441079.1 | MurR/RpiR family transcriptional regulator | - |
| P9M40_RS23645 (4746092) | 4746092..4748230 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| P9M40_RS23650 (4748539) | 4748539..4749003 | + | 465 | WP_023302390.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| P9M40_RS23655 (4749007) | 4749007..4749291 | - | 285 | WP_002886902.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| P9M40_RS23660 (4749281) | 4749281..4749523 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| P9M40_RS23665 (4749601) | 4749601..4751511 | - | 1911 | WP_009486549.1 | PRD domain-containing protein | - |
| P9M40_RS23670 (4751534) | 4751534..4752688 | - | 1155 | WP_023302389.1 | lactonase family protein | - |
| P9M40_RS23675 (4752755) | 4752755..4753495 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11125.95 Da Isoelectric Point: 10.3787
>T276987 WP_002886902.1 NZ_CP122469:c4749291-4749007 [Klebsiella pneumoniae subsp. pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GMH2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GLP0 |