Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | kacAT/DUF1778(antitoxin) |
Location | 4663723..4664533 | Replicon | chromosome |
Accession | NZ_CP122469 | ||
Organism | Klebsiella pneumoniae subsp. pneumoniae strain IITJ_BC16 |
Toxin (Protein)
Gene name | KacT | Uniprot ID | A0A332NV98 |
Locus tag | P9M40_RS23275 | Protein ID | WP_014908042.1 |
Coordinates | 4663723..4664256 (-) | Length | 178 a.a. |
Antitoxin (Protein)
Gene name | KacA | Uniprot ID | - |
Locus tag | P9M40_RS23280 | Protein ID | WP_023343051.1 |
Coordinates | 4664267..4664533 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P9M40_RS23270 (4662554) | 4662554..4663675 | + | 1122 | WP_012737335.1 | cupin domain-containing protein | - |
P9M40_RS23275 (4663723) | 4663723..4664256 | - | 534 | WP_014908042.1 | type II toxin-antitoxin system toxin KacT | Toxin |
P9M40_RS23280 (4664267) | 4664267..4664533 | - | 267 | WP_023343051.1 | type II toxin-antitoxin system antitoxin KacA | Antitoxin |
P9M40_RS23285 (4664636) | 4664636..4666069 | - | 1434 | WP_023343050.1 | Cu(+)/Ag(+) sensor histidine kinase | - |
P9M40_RS23290 (4666059) | 4666059..4666742 | - | 684 | WP_002887273.1 | copper response regulator transcription factor CusR | - |
P9M40_RS23295 (4666915) | 4666915..4668300 | + | 1386 | WP_040182471.1 | efflux transporter outer membrane subunit | - |
P9M40_RS23300 (4668318) | 4668318..4668662 | + | 345 | WP_004192220.1 | cation efflux system protein CusF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 178 a.a. Molecular weight: 19795.68 Da Isoelectric Point: 5.2614
>T276986 WP_014908042.1 NZ_CP122469:c4664256-4663723 [Klebsiella pneumoniae subsp. pneumoniae]
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGLGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGLGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
Download Length: 534 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|