Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 63005..63530 Replicon plasmid pU23_IncFIA-IncFIIK
Accession NZ_CP122463
Organism Klebsiella pneumoniae subsp. pneumoniae strain IITJ_U23

Toxin (Protein)


Gene name ccdB Uniprot ID -
Locus tag P9M41_RS27610 Protein ID WP_012539978.1
Coordinates 63225..63530 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID R4WC25
Locus tag P9M41_RS27605 Protein ID WP_015632547.1
Coordinates 63005..63223 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P9M41_RS27580 (P9M41_27580) 58048..59586 - 1539 WP_004201219.1 IS66-like element ISKpn24 family transposase -
P9M41_RS27585 (P9M41_27585) 59635..59982 - 348 WP_000612626.1 IS66 family insertion sequence element accessory protein TnpB -
P9M41_RS27590 (P9M41_27590) 59979..60383 - 405 WP_003031976.1 transposase -
P9M41_RS27595 (P9M41_27595) 60872..61057 + 186 WP_032433930.1 hypothetical protein -
P9M41_RS27600 (P9M41_27600) 61130..62149 - 1020 WP_138089330.1 hypothetical protein -
P9M41_RS27605 (P9M41_27605) 63005..63223 + 219 WP_015632547.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
P9M41_RS27610 (P9M41_27610) 63225..63530 + 306 WP_012539978.1 type II toxin-antitoxin system toxin CcdB Toxin
P9M41_RS27615 (P9M41_27615) 63717..64721 + 1005 WP_029497484.1 hypothetical protein -
P9M41_RS27620 (P9M41_27620) 64919..65698 + 780 WP_015632549.1 site-specific integrase -
P9M41_RS27625 (P9M41_27625) 65756..66013 - 258 WP_032433931.1 hypothetical protein -
P9M41_RS27630 (P9M41_27630) 66141..66254 - 114 WP_032072094.1 hypothetical protein -
P9M41_RS27635 (P9M41_27635) 66886..67641 + 756 WP_012539983.1 replication initiation protein RepE -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid qnrB1 / ARR-3 / rmtF - 1..146163 146163


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11601.27 Da        Isoelectric Point: 6.4661

>T276976 WP_012539978.1 NZ_CP122463:63225-63530 [Klebsiella pneumoniae subsp. pneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDDSYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8362.31 Da        Isoelectric Point: 4.7247

>AT276976 WP_015632547.1 NZ_CP122463:63005-63223 [Klebsiella pneumoniae subsp. pneumoniae]
MKQRITVTIDSDSYQLLKSADVNISALVNRAMQNEARRLRAERWQAENQEGMAEVARFIDMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A2L1KT86

References