Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 59915..60651 Replicon plasmid pU23_IncFIBK
Accession NZ_CP122462
Organism Klebsiella pneumoniae subsp. pneumoniae strain IITJ_U23

Toxin (Protein)


Gene name tacT Uniprot ID L7SZ15
Locus tag P9M41_RS26620 Protein ID WP_003026803.1
Coordinates 60169..60651 (+) Length 161 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID L7SZ29
Locus tag P9M41_RS26615 Protein ID WP_003026799.1
Coordinates 59915..60181 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P9M41_RS26570 (P9M41_26570) 55977..56339 - 363 WP_004152100.1 arsenite efflux transporter metallochaperone ArsD -
P9M41_RS26575 (P9M41_26575) 56389..56739 - 351 WP_004152101.1 As(III)-sensing metalloregulatory transcriptional repressor ArsR -
P9M41_RS26580 (P9M41_26580) 57097..57366 + 270 WP_004152102.1 hypothetical protein -
P9M41_RS26585 (P9M41_26585) 57354..57929 + 576 WP_004152103.1 hypothetical protein -
P9M41_RS26590 (P9M41_26590) 57960..58454 + 495 WP_004152104.1 DNA-binding protein -
P9M41_RS26595 (P9M41_26595) 58498..58866 + 369 WP_004152105.1 hypothetical protein -
P9M41_RS26600 (P9M41_26600) 58900..59103 + 204 WP_004152106.1 HHA domain-containing protein -
P9M41_RS26605 (P9M41_26605) 59152..59409 + 258 WP_004152107.1 hypothetical protein -
P9M41_RS26610 (P9M41_26610) 59485..59739 + 255 WP_004152108.1 hypothetical protein -
P9M41_RS26615 (P9M41_26615) 59915..60181 + 267 WP_003026799.1 DUF1778 domain-containing protein Antitoxin
P9M41_RS26620 (P9M41_26620) 60169..60651 + 483 WP_003026803.1 GNAT family N-acetyltransferase Toxin
P9M41_RS26625 (P9M41_26625) 60859..62205 + 1347 WP_077255522.1 ISNCY family transposase -
P9M41_RS26630 (P9M41_26630) 62254..62652 + 399 WP_032422684.1 helix-turn-helix domain-containing protein -
P9M41_RS26635 (P9M41_26635) 62848..64194 + 1347 WP_020314316.1 ISNCY family transposase -
P9M41_RS26640 (P9M41_26640) 64355..64486 + 132 WP_004218042.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid aph(3')-Ia / blaOXA-1 / aac(6')-Ib-cr / blaCTX-M-15 / blaTEM-1B / mph(A) / sul1 / qacE / aadA2 / dfrA12 - 1..175206 175206


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(45-149)

Antitoxin

Vibrio phage ICP1, Orf50

(6-82)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17353.97 Da        Isoelectric Point: 9.5822

>T276975 WP_003026803.1 NZ_CP122462:60169-60651 [Klebsiella pneumoniae subsp. pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP

Download         Length: 483 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10147.59 Da        Isoelectric Point: 4.5256

>AT276975 WP_003026799.1 NZ_CP122462:59915-60181 [Klebsiella pneumoniae subsp. pneumoniae]
MKSDVQLNLRAKESQRALIDAAAEILHKSRTDFILEMACKAAENVILDRRVFNFNDEQYAEFIDMLDAPVEDEPAINKLL
ARKPQWDV

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0J2GNW6

Antitoxin

Source ID Structure
AlphaFold DB A0A1Q8YL66

References