Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | kacAT/DUF1778(antitoxin) |
| Location | 4662684..4663494 | Replicon | chromosome |
| Accession | NZ_CP122461 | ||
| Organism | Klebsiella pneumoniae subsp. pneumoniae strain IITJ_U23 | ||
Toxin (Protein)
| Gene name | KacT | Uniprot ID | A0A332NV98 |
| Locus tag | P9M41_RS23285 | Protein ID | WP_014908042.1 |
| Coordinates | 4662684..4663217 (-) | Length | 178 a.a. |
Antitoxin (Protein)
| Gene name | KacA | Uniprot ID | - |
| Locus tag | P9M41_RS23290 | Protein ID | WP_023343051.1 |
| Coordinates | 4663228..4663494 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P9M41_RS23280 (4661515) | 4661515..4662636 | + | 1122 | WP_012737335.1 | cupin domain-containing protein | - |
| P9M41_RS23285 (4662684) | 4662684..4663217 | - | 534 | WP_014908042.1 | type II toxin-antitoxin system toxin KacT | Toxin |
| P9M41_RS23290 (4663228) | 4663228..4663494 | - | 267 | WP_023343051.1 | type II toxin-antitoxin system antitoxin KacA | Antitoxin |
| P9M41_RS23295 (4663597) | 4663597..4665030 | - | 1434 | WP_023343050.1 | Cu(+)/Ag(+) sensor histidine kinase | - |
| P9M41_RS23300 (4665020) | 4665020..4665703 | - | 684 | WP_002887273.1 | copper response regulator transcription factor CusR | - |
| P9M41_RS23305 (4665876) | 4665876..4667261 | + | 1386 | WP_040182471.1 | efflux transporter outer membrane subunit | - |
| P9M41_RS23310 (4667279) | 4667279..4667623 | + | 345 | WP_004192220.1 | cation efflux system protein CusF | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 178 a.a. Molecular weight: 19795.68 Da Isoelectric Point: 5.2614
>T276971 WP_014908042.1 NZ_CP122461:c4663217-4662684 [Klebsiella pneumoniae subsp. pneumoniae]
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGLGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGLGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
Download Length: 534 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|