Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4042412..4043031 Replicon chromosome
Accession NZ_CP122461
Organism Klebsiella pneumoniae subsp. pneumoniae strain IITJ_U23

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag P9M41_RS20295 Protein ID WP_002892050.1
Coordinates 4042813..4043031 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag P9M41_RS20290 Protein ID WP_002892066.1
Coordinates 4042412..4042786 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P9M41_RS20280 (4037564) 4037564..4038757 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
P9M41_RS20285 (4038780) 4038780..4041926 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
P9M41_RS20290 (4042412) 4042412..4042786 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
P9M41_RS20295 (4042813) 4042813..4043031 + 219 WP_002892050.1 HHA domain-containing protein Toxin
P9M41_RS20300 (4043194) 4043194..4043760 + 567 WP_002892030.1 maltose O-acetyltransferase -
P9M41_RS20305 (4043732) 4043732..4043872 - 141 WP_004147370.1 hypothetical protein -
P9M41_RS20310 (4043893) 4043893..4044363 + 471 WP_040182126.1 YlaC family protein -
P9M41_RS20315 (4044338) 4044338..4045789 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
P9M41_RS20320 (4045890) 4045890..4046588 + 699 WP_002892021.1 GNAT family protein -
P9M41_RS20325 (4046585) 4046585..4046725 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
P9M41_RS20330 (4046725) 4046725..4046988 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T276970 WP_002892050.1 NZ_CP122461:4042813-4043031 [Klebsiella pneumoniae subsp. pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT276970 WP_002892066.1 NZ_CP122461:4042412-4042786 [Klebsiella pneumoniae subsp. pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References