Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 489965..490602 | Replicon | chromosome |
| Accession | NZ_CP122460 | ||
| Organism | Bacillus velezensis strain JJYY | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | G4NU33 |
| Locus tag | P9L71_RS02505 | Protein ID | WP_003156187.1 |
| Coordinates | 490252..490602 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | I2HMS5 |
| Locus tag | P9L71_RS02500 | Protein ID | WP_003156188.1 |
| Coordinates | 489965..490246 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P9L71_RS02480 (P9L71_02480) | 486330..486929 | - | 600 | WP_032872997.1 | rhomboid family intramembrane serine protease | - |
| P9L71_RS02485 (P9L71_02485) | 487022..487387 | + | 366 | WP_007609580.1 | holo-ACP synthase | - |
| P9L71_RS02490 (P9L71_02490) | 487552..488559 | + | 1008 | WP_032872999.1 | outer membrane lipoprotein carrier protein LolA | - |
| P9L71_RS02495 (P9L71_02495) | 488676..489845 | + | 1170 | WP_032873001.1 | alanine racemase | - |
| P9L71_RS02500 (P9L71_02500) | 489965..490246 | + | 282 | WP_003156188.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
| P9L71_RS02505 (P9L71_02505) | 490252..490602 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| P9L71_RS02510 (P9L71_02510) | 490720..491541 | + | 822 | WP_003156182.1 | STAS domain-containing protein | - |
| P9L71_RS02515 (P9L71_02515) | 491546..491911 | + | 366 | WP_003156180.1 | RsbT antagonist protein RsbS | - |
| P9L71_RS02520 (P9L71_02520) | 491914..492315 | + | 402 | WP_003156178.1 | anti-sigma regulatory factor | - |
| P9L71_RS02525 (P9L71_02525) | 492327..493334 | + | 1008 | WP_007609589.1 | PP2C family protein-serine/threonine phosphatase | - |
| P9L71_RS02530 (P9L71_02530) | 493398..493727 | + | 330 | WP_003156176.1 | anti-sigma factor antagonist RsbV | - |
| P9L71_RS02535 (P9L71_02535) | 493724..494206 | + | 483 | WP_007609591.1 | anti-sigma B factor RsbW | - |
| P9L71_RS02540 (P9L71_02540) | 494172..494960 | + | 789 | WP_032873003.1 | RNA polymerase sigma factor SigB | - |
| P9L71_RS02545 (P9L71_02545) | 494960..495562 | + | 603 | WP_007410234.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T276960 WP_003156187.1 NZ_CP122460:490252-490602 [Bacillus velezensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|