Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 4164273..4164916 | Replicon | chromosome |
Accession | NZ_CP122457 | ||
Organism | Salmonella enterica subsp. enterica strain TZ282 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | B5F3H8 |
Locus tag | QCX26_RS20035 | Protein ID | WP_000048134.1 |
Coordinates | 4164500..4164916 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | B5F3H9 |
Locus tag | QCX26_RS20030 | Protein ID | WP_001261294.1 |
Coordinates | 4164273..4164503 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QCX26_RS20020 (4161288) | 4161288..4163426 | + | 2139 | WP_000187822.1 | anaerobic ribonucleoside-triphosphate reductase | - |
QCX26_RS20025 (4163642) | 4163642..4164106 | + | 465 | WP_076736138.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
QCX26_RS20030 (4164273) | 4164273..4164503 | + | 231 | WP_001261294.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
QCX26_RS20035 (4164500) | 4164500..4164916 | + | 417 | WP_000048134.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QCX26_RS20040 (4164977) | 4164977..4166890 | - | 1914 | WP_139763623.1 | BglG family transcription antiterminator | - |
QCX26_RS20045 (4166907) | 4166907..4167647 | - | 741 | WP_079984068.1 | KDGP aldolase family protein | - |
QCX26_RS20050 (4167644) | 4167644..4168762 | - | 1119 | WP_079984067.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
QCX26_RS20055 (4168746) | 4168746..4169879 | - | 1134 | WP_079984066.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15135.50 Da Isoelectric Point: 8.1381
>T276957 WP_000048134.1 NZ_CP122457:4164500-4164916 [Salmonella enterica subsp. enterica]
MSKTYMLDTCICSFIMREQPEAVLKRLEQAVLRRHRIVVSAITYAEMRFGCTGKKASPRHAQLVDAFCSRLDAVLAWDRA
AVDATTEIRAVLAAAGTPIGSNDAAIAGHAIASGAILVTNNVREFERVPGLQYEDWVK
MSKTYMLDTCICSFIMREQPEAVLKRLEQAVLRRHRIVVSAITYAEMRFGCTGKKASPRHAQLVDAFCSRLDAVLAWDRA
AVDATTEIRAVLAAAGTPIGSNDAAIAGHAIASGAILVTNNVREFERVPGLQYEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2T8L749 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V4SIC2 |