Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3412382..3413002 | Replicon | chromosome |
Accession | NZ_CP122457 | ||
Organism | Salmonella enterica subsp. enterica strain TZ282 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | QCX26_RS16495 | Protein ID | WP_001280991.1 |
Coordinates | 3412784..3413002 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | QCX26_RS16490 | Protein ID | WP_000344807.1 |
Coordinates | 3412382..3412756 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QCX26_RS16480 (3407521) | 3407521..3408714 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
QCX26_RS16485 (3408737) | 3408737..3411886 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
QCX26_RS16490 (3412382) | 3412382..3412756 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
QCX26_RS16495 (3412784) | 3412784..3413002 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
QCX26_RS16500 (3413181) | 3413181..3413732 | + | 552 | WP_001278792.1 | maltose O-acetyltransferase | - |
QCX26_RS16505 (3413849) | 3413849..3414319 | + | 471 | WP_000136181.1 | YlaC family protein | - |
QCX26_RS16510 (3414375) | 3414375..3414515 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
QCX26_RS16515 (3414521) | 3414521..3414781 | - | 261 | WP_254520504.1 | type B 50S ribosomal protein L31 | - |
QCX26_RS16520 (3415006) | 3415006..3416556 | + | 1551 | WP_154023596.1 | EAL domain-containing protein | - |
QCX26_RS16530 (3416787) | 3416787..3417176 | + | 390 | WP_000961285.1 | MGMT family protein | - |
QCX26_RS16535 (3417209) | 3417209..3417778 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T276953 WP_001280991.1 NZ_CP122457:3412784-3413002 [Salmonella enterica subsp. enterica]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT276953 WP_000344807.1 NZ_CP122457:3412382-3412756 [Salmonella enterica subsp. enterica]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|