Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 2293830..2294352 | Replicon | chromosome |
Accession | NZ_CP122457 | ||
Organism | Salmonella enterica subsp. enterica strain TZ282 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | - |
Locus tag | QCX26_RS11080 | Protein ID | WP_079984302.1 |
Coordinates | 2293830..2294114 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | QCX26_RS11085 | Protein ID | WP_000885424.1 |
Coordinates | 2294104..2294352 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QCX26_RS11060 (2289905) | 2289905..2291413 | - | 1509 | WP_079984305.1 | FAD-dependent oxidoreductase | - |
QCX26_RS11065 (2291458) | 2291458..2291946 | + | 489 | WP_283880732.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
QCX26_RS11070 (2292139) | 2292139..2293212 | + | 1074 | WP_079984303.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
QCX26_RS11075 (2293270) | 2293270..2293659 | - | 390 | WP_000194089.1 | RidA family protein | - |
QCX26_RS11080 (2293830) | 2293830..2294114 | - | 285 | WP_079984302.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QCX26_RS11085 (2294104) | 2294104..2294352 | - | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
QCX26_RS11090 (2294478) | 2294478..2294669 | - | 192 | Protein_2168 | hypothetical protein | - |
QCX26_RS11095 (2295034) | 2295034..2295150 | + | 117 | Protein_2169 | IS110 family transposase | - |
QCX26_RS11100 (2295219) | 2295219..2295551 | + | 333 | WP_079984301.1 | DUF1493 family protein | - |
QCX26_RS11105 (2296427) | 2296427..2297335 | + | 909 | WP_079798353.1 | LysR family transcriptional regulator | - |
QCX26_RS11110 (2297509) | 2297509..2298489 | + | 981 | WP_079984298.1 | nitronate monooxygenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2291458..2300207 | 8749 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11105.87 Da Isoelectric Point: 10.6500
>T276948 WP_079984302.1 NZ_CP122457:c2294114-2293830 [Salmonella enterica subsp. enterica]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPTSQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPTSQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|