Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 845715..846340 | Replicon | chromosome |
Accession | NZ_CP122457 | ||
Organism | Salmonella enterica subsp. enterica strain TZ282 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QCX26_RS04075 | Protein ID | WP_283880494.1 |
Coordinates | 845942..846340 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | C0PXM4 |
Locus tag | QCX26_RS04070 | Protein ID | WP_000557545.1 |
Coordinates | 845715..845942 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QCX26_RS04040 (840770) | 840770..841868 | + | 1099 | WP_010989230.1 | peptide chain release factor 2 | - |
QCX26_RS04045 (841878) | 841878..843395 | + | 1518 | WP_000003339.1 | lysine--tRNA ligase | - |
QCX26_RS04050 (843471) | 843471..844016 | - | 546 | WP_000134000.1 | isopentenyl-diphosphate Delta-isomerase | - |
QCX26_RS04055 (844281) | 844281..845039 | + | 759 | WP_000244328.1 | amidase activator ActS | - |
QCX26_RS04065 (845294) | 845294..845506 | - | 213 | WP_063808845.1 | hypothetical protein | - |
QCX26_RS04070 (845715) | 845715..845942 | + | 228 | WP_000557545.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
QCX26_RS04075 (845942) | 845942..846340 | + | 399 | WP_283880494.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
QCX26_RS04080 (847145) | 847145..847681 | + | 537 | WP_001038500.1 | STM3031 family outer membrane protein | - |
QCX26_RS04085 (847728) | 847728..848360 | + | 633 | WP_283880498.1 | YfdX family protein | - |
QCX26_RS04090 (849079) | 849079..849660 | + | 582 | WP_283880499.1 | fimbrial protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 845294..854117 | 8823 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15018.38 Da Isoelectric Point: 7.2927
>T276946 WP_283880494.1 NZ_CP122457:845942-846340 [Salmonella enterica subsp. enterica]
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPEHNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPEHNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|