Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 835946..836606 | Replicon | chromosome |
Accession | NZ_CP122457 | ||
Organism | Salmonella enterica subsp. enterica strain TZ282 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | Q57K70 |
Locus tag | QCX26_RS04015 | Protein ID | WP_000244756.1 |
Coordinates | 836193..836606 (+) | Length | 138 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S5MU13 |
Locus tag | QCX26_RS04010 | Protein ID | WP_000351186.1 |
Coordinates | 835946..836212 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QCX26_RS03990 (831875) | 831875..833308 | - | 1434 | WP_001230141.1 | 6-phospho-beta-glucosidase BglA | - |
QCX26_RS03995 (833466) | 833466..833777 | + | 312 | WP_001182976.1 | N(4)-acetylcytidine aminohydrolase | - |
QCX26_RS04000 (833941) | 833941..834600 | + | 660 | WP_079983857.1 | hemolysin III family protein | - |
QCX26_RS04005 (834716) | 834716..835696 | - | 981 | WP_000874175.1 | tRNA-modifying protein YgfZ | - |
QCX26_RS04010 (835946) | 835946..836212 | + | 267 | WP_000351186.1 | FAD assembly factor SdhE | Antitoxin |
QCX26_RS04015 (836193) | 836193..836606 | + | 414 | WP_000244756.1 | protein YgfX | Toxin |
QCX26_RS04020 (836659) | 836659..837180 | - | 522 | WP_001055885.1 | flavodoxin FldB | - |
QCX26_RS04025 (837293) | 837293..838189 | + | 897 | WP_079983858.1 | site-specific tyrosine recombinase XerD | - |
QCX26_RS04030 (838213) | 838213..838926 | + | 714 | WP_000745614.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
QCX26_RS04035 (838932) | 838932..840665 | + | 1734 | WP_000813394.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 16183.15 Da Isoelectric Point: 10.7537
>T276945 WP_000244756.1 NZ_CP122457:836193-836606 [Salmonella enterica subsp. enterica]
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3Z1E9V5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0YWH4 |