Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 49181..49706 | Replicon | plasmid p1 |
| Accession | NZ_CP122455 | ||
| Organism | Escherichia coli strain 82.0311 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | S1PFV8 |
| Locus tag | QBY76_RS25280 | Protein ID | WP_001159871.1 |
| Coordinates | 49401..49706 (+) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | S1PPD8 |
| Locus tag | QBY76_RS25275 | Protein ID | WP_000813634.1 |
| Coordinates | 49181..49399 (+) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QBY76_RS25270 (46218) | 46218..46859 | - | 642 | WP_000990667.1 | hypothetical protein | - |
| QBY76_RS25275 (49181) | 49181..49399 | + | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| QBY76_RS25280 (49401) | 49401..49706 | + | 306 | WP_001159871.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| QBY76_RS25285 (49707) | 49707..50516 | + | 810 | WP_000016979.1 | site-specific integrase | - |
| QBY76_RS25290 (50654) | 50654..50929 | - | 276 | WP_000239529.1 | hypothetical protein | - |
| QBY76_RS25295 (50923) | 50923..51567 | - | 645 | WP_000633911.1 | AAA family ATPase | - |
| QBY76_RS25300 (51796) | 51796..52767 | + | 972 | WP_001103694.1 | plasmid segregation protein ParM | - |
| QBY76_RS25305 (52772) | 52772..53164 | + | 393 | WP_000340835.1 | plasmid partitioning/stability family protein | - |
| QBY76_RS25310 (53169) | 53169..54439 | - | 1271 | Protein_56 | translesion error-prone DNA polymerase V subunit UmuC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | senB | 1..114230 | 114230 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11692.49 Da Isoelectric Point: 6.4674
>T276940 WP_001159871.1 NZ_CP122455:49401-49706 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CCE8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 3TCJ | |
| PDB | 2H3A | |
| PDB | 2ADN | |
| PDB | 2ADL | |
| PDB | 3HPW | |
| PDB | 2H3C | |
| PDB | 3G7Z | |
| AlphaFold DB | A0A829CQY2 |