Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4483323..4484121 | Replicon | chromosome |
| Accession | NZ_CP122454 | ||
| Organism | Escherichia coli strain 82.0311 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A1M0HL60 |
| Locus tag | QBY76_RS21800 | Protein ID | WP_000854692.1 |
| Coordinates | 4483744..4484121 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A1L4NTN5 |
| Locus tag | QBY76_RS21795 | Protein ID | WP_001605875.1 |
| Coordinates | 4483323..4483697 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QBY76_RS21775 (4481070) | 4481070..4481888 | + | 819 | WP_001234393.1 | DUF932 domain-containing protein | - |
| QBY76_RS21780 (4481980) | 4481980..4482465 | + | 486 | WP_094321476.1 | antirestriction protein | - |
| QBY76_RS21785 (4482481) | 4482481..4482957 | + | 477 | WP_001186181.1 | RadC family protein | - |
| QBY76_RS21790 (4483026) | 4483026..4483247 | + | 222 | WP_000692323.1 | DUF987 domain-containing protein | - |
| QBY76_RS21795 (4483323) | 4483323..4483697 | + | 375 | WP_001605875.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| QBY76_RS21800 (4483744) | 4483744..4484121 | + | 378 | WP_000854692.1 | TA system toxin CbtA family protein | Toxin |
| QBY76_RS21805 (4484118) | 4484118..4484267 | + | 150 | Protein_4271 | DUF5983 family protein | - |
| QBY76_RS21810 (4484343) | 4484343..4484540 | + | 198 | WP_023563519.1 | DUF957 domain-containing protein | - |
| QBY76_RS21815 (4484625) | 4484625..4485467 | + | 843 | WP_001529559.1 | DUF4942 domain-containing protein | - |
| QBY76_RS21820 (4485810) | 4485810..4485980 | + | 171 | Protein_4274 | IS110 family transposase | - |
| QBY76_RS21825 (4486779) | 4486779..4487762 | + | 984 | WP_001331698.1 | KpsF/GutQ family sugar-phosphate isomerase | - |
| QBY76_RS21830 (4487834) | 4487834..4488982 | + | 1149 | WP_000905922.1 | capsule polysaccharide export inner-membrane protein KpsE | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 4485876..4485980 | 104 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14119.12 Da Isoelectric Point: 7.3249
>T276937 WP_000854692.1 NZ_CP122454:4483744-4484121 [Escherichia coli]
MKTLPDTHVREASCCPSPVTIWHTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAKQ
MKTLPDTHVREASCCPSPVTIWHTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13594.42 Da Isoelectric Point: 5.4554
>AT276937 WP_001605875.1 NZ_CP122454:4483323-4483697 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLACEADTLGSCGYVYMAVYPTLAPATTS
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLACEADTLGSCGYVYMAVYPTLAPATTS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1M0HL60 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1L4NTN5 |