Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 4357874..4358528 | Replicon | chromosome |
Accession | NZ_CP122454 | ||
Organism | Escherichia coli strain 82.0311 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1PAM6 |
Locus tag | QBY76_RS21130 | Protein ID | WP_000244781.1 |
Coordinates | 4357874..4358281 (-) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | QBY76_RS21135 | Protein ID | WP_000354046.1 |
Coordinates | 4358262..4358528 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QBY76_RS21110 (4353831) | 4353831..4355564 | - | 1734 | WP_000813195.1 | single-stranded-DNA-specific exonuclease RecJ | - |
QBY76_RS21115 (4355570) | 4355570..4356280 | - | 711 | WP_000715230.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
QBY76_RS21120 (4356305) | 4356305..4357201 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
QBY76_RS21125 (4357313) | 4357313..4357834 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
QBY76_RS21130 (4357874) | 4357874..4358281 | - | 408 | WP_000244781.1 | protein YgfX | Toxin |
QBY76_RS21135 (4358262) | 4358262..4358528 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
QBY76_RS21140 (4358771) | 4358771..4359751 | + | 981 | WP_000886078.1 | tRNA-modifying protein YgfZ | - |
QBY76_RS21145 (4359828) | 4359828..4360487 | - | 660 | WP_000250274.1 | hemolysin III family protein | - |
QBY76_RS21150 (4360651) | 4360651..4360962 | - | 312 | WP_001182959.1 | N(4)-acetylcytidine aminohydrolase | - |
QBY76_RS21155 (4361007) | 4361007..4362440 | + | 1434 | WP_001339296.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T276936 WP_000244781.1 NZ_CP122454:c4358281-4357874 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|