Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 4182408..4182991 | Replicon | chromosome |
Accession | NZ_CP122454 | ||
Organism | Escherichia coli strain 82.0311 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | V0SV58 |
Locus tag | QBY76_RS20385 | Protein ID | WP_000254750.1 |
Coordinates | 4182408..4182743 (-) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S1P3W5 |
Locus tag | QBY76_RS20390 | Protein ID | WP_000581937.1 |
Coordinates | 4182743..4182991 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QBY76_RS20370 (4178294) | 4178294..4179592 | - | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
QBY76_RS20375 (4179680) | 4179680..4181317 | - | 1638 | WP_021531536.1 | CTP synthase (glutamine hydrolyzing) | - |
QBY76_RS20380 (4181545) | 4181545..4182336 | - | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
QBY76_RS20385 (4182408) | 4182408..4182743 | - | 336 | WP_000254750.1 | endoribonuclease MazF | Toxin |
QBY76_RS20390 (4182743) | 4182743..4182991 | - | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
QBY76_RS20395 (4183069) | 4183069..4185303 | - | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
QBY76_RS20400 (4185351) | 4185351..4186652 | - | 1302 | WP_000046817.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
QBY76_RS20405 (4186709) | 4186709..4187218 | + | 510 | Protein_3997 | two-component sensor histidine kinase BarA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 4187296..4188219 | 923 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12067.95 Da Isoelectric Point: 8.2618
>T276935 WP_000254750.1 NZ_CP122454:c4182743-4182408 [Escherichia coli]
MVSRYVPDTGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDTGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|