Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 3419743..3420574 Replicon chromosome
Accession NZ_CP122454
Organism Escherichia coli strain 82.0311

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag QBY76_RS16855 Protein ID WP_000854814.1
Coordinates 3420200..3420574 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID S1PWQ3
Locus tag QBY76_RS16850 Protein ID WP_001285586.1
Coordinates 3419743..3420111 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QBY76_RS16815 (3414800) 3414800..3415870 + 1071 WP_000102631.1 patatin-like phospholipase family protein -
QBY76_RS16820 (3416006) 3416006..3416683 + 678 WP_001362823.1 hypothetical protein -
QBY76_RS16825 (3416699) 3416699..3417109 + 411 WP_000846704.1 hypothetical protein -
QBY76_RS16830 (3417330) 3417330..3418151 + 822 WP_001234571.1 DUF932 domain-containing protein -
QBY76_RS16835 (3418414) 3418414..3418887 + 474 WP_000855074.1 antirestriction protein -
QBY76_RS16840 (3418903) 3418903..3419379 + 477 WP_001351157.1 RadC family protein -
QBY76_RS16845 (3419448) 3419448..3419669 + 222 WP_000692323.1 DUF987 domain-containing protein -
QBY76_RS16850 (3419743) 3419743..3420111 + 369 WP_001285586.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
QBY76_RS16855 (3420200) 3420200..3420574 + 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QBY76_RS16860 (3420571) 3420571..3420765 + 195 WP_000988601.1 DUF5983 family protein -
QBY76_RS16865 (3420811) 3420811..3420891 + 81 Protein_3306 hypothetical protein -
QBY76_RS16870 (3421180) 3421180..3421260 - 81 WP_023441679.1 hypothetical protein -
QBY76_RS16875 (3421239) 3421239..3421562 + 324 WP_223216378.1 EutP/PduV family microcompartment system protein -
QBY76_RS16880 (3421663) 3421663..3421992 - 330 WP_000450409.1 DUF496 family protein -
QBY76_RS16885 (3422164) 3422164..3423222 - 1059 WP_001200890.1 FUSC family protein -
QBY76_RS16890 (3423420) 3423420..3423893 - 474 WP_001105376.1 DNA gyrase inhibitor SbmC -
QBY76_RS16895 (3424012) 3424012..3425178 - 1167 WP_001297905.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T276932 WP_000854814.1 NZ_CP122454:3420200-3420574 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13563.41 Da        Isoelectric Point: 5.0468

>AT276932 WP_001285586.1 NZ_CP122454:3419743-3420111 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELSPRYQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
AlphaFold DB S1PWQ3

References