Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 2314770..2315571 Replicon chromosome
Accession NZ_CP122454
Organism Escherichia coli strain 82.0311

Toxin (Protein)


Gene name yeeV Uniprot ID A0A0H2V687
Locus tag QBY76_RS11250 Protein ID WP_000854739.1
Coordinates 2315191..2315571 (+) Length 127 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A0P7R0L9
Locus tag QBY76_RS11245 Protein ID WP_001285482.1
Coordinates 2314770..2315144 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QBY76_RS11205 (2310782) 2310782..2311237 + 456 WP_000581502.1 IrmA family protein -
QBY76_RS11210 (2311380) 2311380..2311469 + 90 WP_112031555.1 DUF905 family protein -
QBY76_RS11215 (2311648) 2311648..2312469 + 822 WP_001535267.1 DUF932 domain-containing protein -
QBY76_RS11220 (2312469) 2312469..2312714 + 246 WP_001164966.1 hypothetical protein -
QBY76_RS11225 (2312808) 2312808..2313281 + 474 WP_001313575.1 antirestriction protein -
QBY76_RS11230 (2313297) 2313297..2313773 + 477 WP_001186193.1 RadC family protein -
QBY76_RS11235 (2313836) 2313836..2314057 + 222 WP_000692315.1 DUF987 domain-containing protein -
QBY76_RS11240 (2314076) 2314076..2314720 + 645 WP_021522037.1 hypothetical protein -
QBY76_RS11245 (2314770) 2314770..2315144 + 375 WP_001285482.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QBY76_RS11250 (2315191) 2315191..2315571 + 381 WP_000854739.1 TA system toxin CbtA family protein Toxin
QBY76_RS11255 (2315568) 2315568..2316056 + 489 WP_001054232.1 DUF5983 family protein -
QBY76_RS11260 (2316076) 2316076..2316273 + 198 WP_000772027.1 DUF957 domain-containing protein -
QBY76_RS11265 (2316358) 2316358..2317201 + 844 Protein_2201 DUF4942 domain-containing protein -
QBY76_RS11275 (2317672) 2317672..2318610 + 939 WP_087597881.1 glyoxylate/hydroxypyruvate reductase GhrA -
QBY76_RS11280 (2318665) 2318665..2319402 + 738 WP_000283664.1 zinc-binding phosphatase -
QBY76_RS11285 (2319426) 2319426..2319980 + 555 WP_001001921.1 molecular chaperone YcdY -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 14214.14 Da        Isoelectric Point: 6.4773

>T276925 WP_000854739.1 NZ_CP122454:2315191-2315571 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGVPSQLINSIDILRARRATGLMTRDNYRTVNDITLGRHPEEAKQ

Download         Length: 381 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 13791.44 Da        Isoelectric Point: 4.7511

>AT276925 WP_001285482.1 NZ_CP122454:2314770-2315144 [Escherichia coli]
VSDTLHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H2V687

Antitoxin

Source ID Structure
AlphaFold DB A0A0P7R0L9

References