Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 1568786..1569404 | Replicon | chromosome |
| Accession | NZ_CP122454 | ||
| Organism | Escherichia coli strain 82.0311 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | QBY76_RS07535 | Protein ID | WP_001291435.1 |
| Coordinates | 1568786..1569004 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | QBY76_RS07540 | Protein ID | WP_000344800.1 |
| Coordinates | 1569030..1569404 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QBY76_RS07500 (1564074) | 1564074..1564646 | + | 573 | WP_087597809.1 | YbaY family lipoprotein | - |
| QBY76_RS07505 (1564677) | 1564677..1564988 | - | 312 | WP_000409908.1 | MGMT family protein | - |
| QBY76_RS07515 (1565367) | 1565367..1565720 | + | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
| QBY76_RS07520 (1565762) | 1565762..1567312 | - | 1551 | WP_001538392.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| QBY76_RS07525 (1567476) | 1567476..1567946 | - | 471 | WP_000136192.1 | YlaC family protein | - |
| QBY76_RS07530 (1568062) | 1568062..1568613 | - | 552 | WP_000102539.1 | maltose O-acetyltransferase | - |
| QBY76_RS07535 (1568786) | 1568786..1569004 | - | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| QBY76_RS07540 (1569030) | 1569030..1569404 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| QBY76_RS07545 (1569950) | 1569950..1573099 | - | 3150 | WP_001132480.1 | efflux RND transporter permease AcrB | - |
| QBY76_RS07550 (1573122) | 1573122..1574315 | - | 1194 | WP_001538394.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T276924 WP_001291435.1 NZ_CP122454:c1569004-1568786 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT276924 WP_000344800.1 NZ_CP122454:c1569404-1569030 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |