Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 1096237..1096787 Replicon chromosome
Accession NZ_CP122454
Organism Escherichia coli strain 82.0311

Toxin (Protein)


Gene name ccdB Uniprot ID S1PDG4
Locus tag QBY76_RS05230 Protein ID WP_001160966.1
Coordinates 1096473..1096787 (+) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID S1NMQ0
Locus tag QBY76_RS05225 Protein ID WP_000125568.1
Coordinates 1096237..1096470 (+) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QBY76_RS05200 (1091310) 1091310..1091597 + 288 WP_000203741.1 ferredoxin-like protein FixX -
QBY76_RS05205 (1091656) 1091656..1092987 + 1332 WP_001183198.1 MFS transporter -
QBY76_RS05210 (1093095) 1093095..1093625 + 531 WP_000600732.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
QBY76_RS05215 (1093618) 1093618..1095480 + 1863 WP_000377109.1 glutathione-regulated potassium-efflux system protein KefC -
QBY76_RS05220 (1095672) 1095672..1096151 + 480 WP_000624375.1 type 3 dihydrofolate reductase -
QBY76_RS05225 (1096237) 1096237..1096470 + 234 WP_000125568.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
QBY76_RS05230 (1096473) 1096473..1096787 + 315 WP_001160966.1 CcdB family protein Toxin
QBY76_RS05235 (1096784) 1096784..1097632 - 849 WP_097738039.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
QBY76_RS05240 (1097639) 1097639..1098016 - 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
QBY76_RS05245 (1098019) 1098019..1098840 - 822 WP_001065363.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
QBY76_RS05250 (1098837) 1098837..1099826 - 990 WP_000241225.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
QBY76_RS05255 (1099826) 1099826..1101112 - 1287 WP_000800457.1 peptidylprolyl isomerase SurA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11711.72 Da        Isoelectric Point: 9.0851

>T276922 WP_001160966.1 NZ_CP122454:1096473-1096787 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8560.55 Da        Isoelectric Point: 5.8062

>AT276922 WP_000125568.1 NZ_CP122454:1096237-1096470 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENTEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829G815

Antitoxin

Source ID Structure
AlphaFold DB A0A829GEF2

References