Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 921539..922374 Replicon chromosome
Accession NZ_CP122454
Organism Escherichia coli strain 82.0311

Toxin (Protein)


Gene name yeeV Uniprot ID Q1R2L4
Locus tag QBY76_RS04385 Protein ID WP_001094426.1
Coordinates 921997..922374 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID Q1R2L5
Locus tag QBY76_RS04380 Protein ID WP_001285575.1
Coordinates 921539..921907 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QBY76_RS04345 (917432) 917432..918112 + 681 WP_001282919.1 WYL domain-containing protein -
QBY76_RS04350 (918260) 918260..918937 + 678 WP_001097301.1 hypothetical protein -
QBY76_RS04355 (918943) 918943..919176 + 234 WP_001278290.1 DUF905 family protein -
QBY76_RS04360 (919266) 919266..920084 + 819 WP_001175160.1 DUF932 domain-containing protein -
QBY76_RS04365 (920175) 920175..920660 + 486 WP_000213697.1 antirestriction protein -
QBY76_RS04370 (920675) 920675..921151 + 477 WP_001298074.1 RadC family protein -
QBY76_RS04375 (921238) 921238..921459 + 222 WP_000692350.1 DUF987 domain-containing protein -
QBY76_RS04380 (921539) 921539..921907 + 369 WP_001285575.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QBY76_RS04385 (921997) 921997..922374 + 378 WP_001094426.1 TA system toxin CbtA family protein Toxin
QBY76_RS04390 (922371) 922371..922859 + 489 WP_000761683.1 DUF5983 family protein -
QBY76_RS04395 (922871) 922871..923068 + 198 WP_000839272.1 DUF957 domain-containing protein -
QBY76_RS04400 (923153) 923153..923302 + 150 Protein_859 hypothetical protein -
QBY76_RS04405 (924271) 924271..926295 + 2025 WP_244578867.1 hypothetical protein -
QBY76_RS04410 (926694) 926694..926873 - 180 Protein_861 peptidase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - fimB / fimE / fimA / fimI / fimC 908836..936458 27622


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14072.99 Da        Isoelectric Point: 7.3523

>T276921 WP_001094426.1 NZ_CP122454:921997-922374 [Escherichia coli]
MNTLPDTHIREASHCQSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13709.52 Da        Isoelectric Point: 6.6258

>AT276921 WP_001285575.1 NZ_CP122454:921539-921907 [Escherichia coli]
VSDTLPGTTHPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKRLTCEADTLGSCGYVYMAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A454ABD6

Antitoxin

Source ID Structure
AlphaFold DB A0A454ABF5

References