Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4244222..4244772 Replicon chromosome
Accession NZ_CP122451
Organism Escherichia coli strain 82.0312

Toxin (Protein)


Gene name ccdB Uniprot ID S1PDG4
Locus tag QBY78_RS20760 Protein ID WP_001160966.1
Coordinates 4244222..4244536 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID S1NMQ0
Locus tag QBY78_RS20765 Protein ID WP_000125568.1
Coordinates 4244539..4244772 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QBY78_RS20735 (4239897) 4239897..4241183 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
QBY78_RS20740 (4241183) 4241183..4242172 + 990 WP_000241225.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
QBY78_RS20745 (4242169) 4242169..4242990 + 822 WP_001065363.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
QBY78_RS20750 (4242993) 4242993..4243370 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
QBY78_RS20755 (4243377) 4243377..4244225 + 849 WP_097738039.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
QBY78_RS20760 (4244222) 4244222..4244536 - 315 WP_001160966.1 CcdB family protein Toxin
QBY78_RS20765 (4244539) 4244539..4244772 - 234 WP_000125568.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
QBY78_RS20770 (4244858) 4244858..4245337 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
QBY78_RS20775 (4245529) 4245529..4247391 - 1863 WP_000377109.1 glutathione-regulated potassium-efflux system protein KefC -
QBY78_RS20780 (4247384) 4247384..4247914 - 531 WP_000600732.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
QBY78_RS20785 (4248022) 4248022..4249353 - 1332 WP_001183198.1 MFS transporter -
QBY78_RS20790 (4249412) 4249412..4249699 - 288 WP_000203741.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11711.72 Da        Isoelectric Point: 9.0851

>T276912 WP_001160966.1 NZ_CP122451:c4244536-4244222 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8560.55 Da        Isoelectric Point: 5.8062

>AT276912 WP_000125568.1 NZ_CP122451:c4244772-4244539 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENTEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829G815

Antitoxin

Source ID Structure
AlphaFold DB A0A829GEF2

References