Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3771605..3772223 | Replicon | chromosome |
| Accession | NZ_CP122451 | ||
| Organism | Escherichia coli strain 82.0312 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | QBY78_RS18460 | Protein ID | WP_001291435.1 |
| Coordinates | 3772005..3772223 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | QBY78_RS18455 | Protein ID | WP_000344800.1 |
| Coordinates | 3771605..3771979 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QBY78_RS18445 (3766694) | 3766694..3767887 | + | 1194 | WP_001538394.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| QBY78_RS18450 (3767910) | 3767910..3771059 | + | 3150 | WP_001132480.1 | efflux RND transporter permease AcrB | - |
| QBY78_RS18455 (3771605) | 3771605..3771979 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| QBY78_RS18460 (3772005) | 3772005..3772223 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| QBY78_RS18465 (3772396) | 3772396..3772947 | + | 552 | WP_000102539.1 | maltose O-acetyltransferase | - |
| QBY78_RS18470 (3773063) | 3773063..3773533 | + | 471 | WP_000136192.1 | YlaC family protein | - |
| QBY78_RS18475 (3773697) | 3773697..3775247 | + | 1551 | WP_001538392.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| QBY78_RS18480 (3775289) | 3775289..3775642 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
| QBY78_RS18490 (3776021) | 3776021..3776332 | + | 312 | WP_000409908.1 | MGMT family protein | - |
| QBY78_RS18495 (3776363) | 3776363..3776935 | - | 573 | WP_087597809.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T276910 WP_001291435.1 NZ_CP122451:3772005-3772223 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT276910 WP_000344800.1 NZ_CP122451:3771605-3771979 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |