Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 3025438..3026239 Replicon chromosome
Accession NZ_CP122451
Organism Escherichia coli strain 82.0312

Toxin (Protein)


Gene name yeeV Uniprot ID A0A0H2V687
Locus tag QBY78_RS14750 Protein ID WP_000854739.1
Coordinates 3025438..3025818 (-) Length 127 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A0P7R0L9
Locus tag QBY78_RS14755 Protein ID WP_001285482.1
Coordinates 3025865..3026239 (-) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QBY78_RS14715 (3021029) 3021029..3021583 - 555 WP_001001921.1 molecular chaperone YcdY -
QBY78_RS14720 (3021607) 3021607..3022344 - 738 WP_000283664.1 zinc-binding phosphatase -
QBY78_RS14725 (3022399) 3022399..3023337 - 939 WP_087597881.1 glyoxylate/hydroxypyruvate reductase GhrA -
QBY78_RS14735 (3023808) 3023808..3024651 - 844 Protein_2895 DUF4942 domain-containing protein -
QBY78_RS14740 (3024736) 3024736..3024933 - 198 WP_000772027.1 DUF957 domain-containing protein -
QBY78_RS14745 (3024953) 3024953..3025441 - 489 WP_001054232.1 DUF5983 family protein -
QBY78_RS14750 (3025438) 3025438..3025818 - 381 WP_000854739.1 TA system toxin CbtA family protein Toxin
QBY78_RS14755 (3025865) 3025865..3026239 - 375 WP_001285482.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QBY78_RS14760 (3026289) 3026289..3026933 - 645 WP_021522037.1 hypothetical protein -
QBY78_RS14765 (3026952) 3026952..3027173 - 222 WP_000692315.1 DUF987 domain-containing protein -
QBY78_RS14770 (3027236) 3027236..3027712 - 477 WP_001186193.1 RadC family protein -
QBY78_RS14775 (3027728) 3027728..3028201 - 474 WP_001313575.1 antirestriction protein -
QBY78_RS14780 (3028295) 3028295..3028540 - 246 WP_001164966.1 hypothetical protein -
QBY78_RS14785 (3028540) 3028540..3029361 - 822 WP_001535267.1 DUF932 domain-containing protein -
QBY78_RS14790 (3029540) 3029540..3029629 - 90 WP_112031555.1 DUF905 family protein -
QBY78_RS14795 (3029772) 3029772..3030227 - 456 WP_000581502.1 IrmA family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 14214.14 Da        Isoelectric Point: 6.4773

>T276909 WP_000854739.1 NZ_CP122451:c3025818-3025438 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGVPSQLINSIDILRARRATGLMTRDNYRTVNDITLGRHPEEAKQ

Download         Length: 381 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 13791.44 Da        Isoelectric Point: 4.7511

>AT276909 WP_001285482.1 NZ_CP122451:c3026239-3025865 [Escherichia coli]
VSDTLHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H2V687

Antitoxin

Source ID Structure
AlphaFold DB A0A0P7R0L9

References