Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1921152..1921983 Replicon chromosome
Accession NZ_CP122451
Organism Escherichia coli strain 82.0312

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag QBY78_RS09155 Protein ID WP_000854814.1
Coordinates 1921152..1921526 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID S1PWQ3
Locus tag QBY78_RS09160 Protein ID WP_001285586.1
Coordinates 1921615..1921983 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QBY78_RS09115 (1916548) 1916548..1917714 + 1167 WP_001297905.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -
QBY78_RS09120 (1917833) 1917833..1918306 + 474 WP_001105376.1 DNA gyrase inhibitor SbmC -
QBY78_RS09125 (1918504) 1918504..1919562 + 1059 WP_001200890.1 FUSC family protein -
QBY78_RS09130 (1919734) 1919734..1920063 + 330 WP_000450409.1 DUF496 family protein -
QBY78_RS09135 (1920164) 1920164..1920487 - 324 WP_223216378.1 EutP/PduV family microcompartment system protein -
QBY78_RS09140 (1920466) 1920466..1920546 + 81 WP_023441679.1 hypothetical protein -
QBY78_RS09145 (1920835) 1920835..1920915 - 81 Protein_1792 hypothetical protein -
QBY78_RS09150 (1920961) 1920961..1921155 - 195 WP_000988601.1 DUF5983 family protein -
QBY78_RS09155 (1921152) 1921152..1921526 - 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QBY78_RS09160 (1921615) 1921615..1921983 - 369 WP_001285586.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
QBY78_RS09165 (1922057) 1922057..1922278 - 222 WP_000692323.1 DUF987 domain-containing protein -
QBY78_RS09170 (1922347) 1922347..1922823 - 477 WP_001351157.1 RadC family protein -
QBY78_RS09175 (1922839) 1922839..1923312 - 474 WP_000855074.1 antirestriction protein -
QBY78_RS09180 (1923575) 1923575..1924396 - 822 WP_001234571.1 DUF932 domain-containing protein -
QBY78_RS09185 (1924617) 1924617..1925027 - 411 WP_000846704.1 hypothetical protein -
QBY78_RS09190 (1925043) 1925043..1925720 - 678 WP_001362823.1 hypothetical protein -
QBY78_RS09195 (1925856) 1925856..1926926 - 1071 WP_000102631.1 patatin-like phospholipase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T276902 WP_000854814.1 NZ_CP122451:c1921526-1921152 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13563.41 Da        Isoelectric Point: 5.0468

>AT276902 WP_001285586.1 NZ_CP122451:c1921983-1921615 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELSPRYQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
AlphaFold DB S1PWQ3

References