Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
| Location | 1114325..1114908 | Replicon | chromosome |
| Accession | NZ_CP122451 | ||
| Organism | Escherichia coli strain 82.0312 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | V0SV58 |
| Locus tag | QBY78_RS05345 | Protein ID | WP_000254750.1 |
| Coordinates | 1114573..1114908 (+) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | S1P3W5 |
| Locus tag | QBY78_RS05340 | Protein ID | WP_000581937.1 |
| Coordinates | 1114325..1114573 (+) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QBY78_RS05330 (1110664) | 1110664..1111965 | + | 1302 | WP_000046817.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
| QBY78_RS05335 (1112013) | 1112013..1114247 | + | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
| QBY78_RS05340 (1114325) | 1114325..1114573 | + | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| QBY78_RS05345 (1114573) | 1114573..1114908 | + | 336 | WP_000254750.1 | endoribonuclease MazF | Toxin |
| QBY78_RS05350 (1114980) | 1114980..1115771 | + | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
| QBY78_RS05355 (1115999) | 1115999..1117636 | + | 1638 | WP_021531536.1 | CTP synthase (glutamine hydrolyzing) | - |
| QBY78_RS05360 (1117724) | 1117724..1119022 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12067.95 Da Isoelectric Point: 8.2618
>T276899 WP_000254750.1 NZ_CP122451:1114573-1114908 [Escherichia coli]
MVSRYVPDTGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDTGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|