Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 939854..940508 | Replicon | chromosome |
Accession | NZ_CP122451 | ||
Organism | Escherichia coli strain 82.0312 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1PAM6 |
Locus tag | QBY78_RS04610 | Protein ID | WP_000244781.1 |
Coordinates | 940101..940508 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | QBY78_RS04605 | Protein ID | WP_000354046.1 |
Coordinates | 939854..940120 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QBY78_RS04585 (935942) | 935942..937375 | - | 1434 | WP_001339296.1 | 6-phospho-beta-glucosidase BglA | - |
QBY78_RS04590 (937420) | 937420..937731 | + | 312 | WP_001182959.1 | N(4)-acetylcytidine aminohydrolase | - |
QBY78_RS04595 (937895) | 937895..938554 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
QBY78_RS04600 (938631) | 938631..939611 | - | 981 | WP_000886078.1 | tRNA-modifying protein YgfZ | - |
QBY78_RS04605 (939854) | 939854..940120 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
QBY78_RS04610 (940101) | 940101..940508 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
QBY78_RS04615 (940548) | 940548..941069 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
QBY78_RS04620 (941181) | 941181..942077 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
QBY78_RS04625 (942102) | 942102..942812 | + | 711 | WP_000715230.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
QBY78_RS04630 (942818) | 942818..944551 | + | 1734 | WP_000813195.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T276898 WP_000244781.1 NZ_CP122451:940101-940508 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|