Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 50247..50772 | Replicon | plasmid p1 |
| Accession | NZ_CP122449 | ||
| Organism | Escherichia coli strain 85.0412 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | S1PFV8 |
| Locus tag | QBY77_RS24910 | Protein ID | WP_001159871.1 |
| Coordinates | 50467..50772 (+) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | S1PPD8 |
| Locus tag | QBY77_RS24905 | Protein ID | WP_000813634.1 |
| Coordinates | 50247..50465 (+) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QBY77_RS24900 (47284) | 47284..47925 | - | 642 | WP_000990667.1 | hypothetical protein | - |
| QBY77_RS24905 (50247) | 50247..50465 | + | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| QBY77_RS24910 (50467) | 50467..50772 | + | 306 | WP_001159871.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| QBY77_RS24915 (50773) | 50773..51582 | + | 810 | WP_000016979.1 | site-specific integrase | - |
| QBY77_RS24920 (51720) | 51720..51995 | - | 276 | WP_000239529.1 | hypothetical protein | - |
| QBY77_RS24925 (51989) | 51989..52633 | - | 645 | WP_000633911.1 | AAA family ATPase | - |
| QBY77_RS24930 (52862) | 52862..53833 | + | 972 | WP_001103694.1 | plasmid segregation protein ParM | - |
| QBY77_RS24935 (53838) | 53838..54230 | + | 393 | WP_000340835.1 | plasmid partitioning/stability family protein | - |
| QBY77_RS24940 (54235) | 54235..55505 | - | 1271 | Protein_57 | translesion error-prone DNA polymerase V subunit UmuC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | senB | 1..115290 | 115290 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11692.49 Da Isoelectric Point: 6.4674
>T276892 WP_001159871.1 NZ_CP122449:50467-50772 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CCE8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 3TCJ | |
| PDB | 2H3A | |
| PDB | 2ADN | |
| PDB | 2ADL | |
| PDB | 3HPW | |
| PDB | 2H3C | |
| PDB | 3G7Z | |
| AlphaFold DB | A0A829CQY2 |