Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4332745..4333580 | Replicon | chromosome |
| Accession | NZ_CP122448 | ||
| Organism | Escherichia coli strain 85.0412 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | Q1R2L4 |
| Locus tag | QBY77_RS20995 | Protein ID | WP_001094426.1 |
| Coordinates | 4332745..4333122 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | Q1R2L5 |
| Locus tag | QBY77_RS21000 | Protein ID | WP_001285575.1 |
| Coordinates | 4333212..4333580 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QBY77_RS20970 (4328248) | 4328248..4328427 | + | 180 | Protein_4110 | peptidase | - |
| QBY77_RS20975 (4328826) | 4328826..4330862 | - | 2037 | WP_000417001.1 | hypothetical protein | - |
| QBY77_RS20980 (4331817) | 4331817..4331966 | - | 150 | Protein_4112 | hypothetical protein | - |
| QBY77_RS20985 (4332051) | 4332051..4332248 | - | 198 | WP_000839272.1 | DUF957 domain-containing protein | - |
| QBY77_RS20990 (4332260) | 4332260..4332748 | - | 489 | WP_000761683.1 | DUF5983 family protein | - |
| QBY77_RS20995 (4332745) | 4332745..4333122 | - | 378 | WP_001094426.1 | TA system toxin CbtA family protein | Toxin |
| QBY77_RS21000 (4333212) | 4333212..4333580 | - | 369 | WP_001285575.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QBY77_RS21005 (4333660) | 4333660..4333881 | - | 222 | WP_000692350.1 | DUF987 domain-containing protein | - |
| QBY77_RS21010 (4333968) | 4333968..4334444 | - | 477 | WP_001298074.1 | RadC family protein | - |
| QBY77_RS21015 (4334459) | 4334459..4334944 | - | 486 | WP_000213697.1 | antirestriction protein | - |
| QBY77_RS21020 (4335035) | 4335035..4335853 | - | 819 | WP_001175160.1 | DUF932 domain-containing protein | - |
| QBY77_RS21025 (4335943) | 4335943..4336176 | - | 234 | WP_001278290.1 | DUF905 family protein | - |
| QBY77_RS21030 (4336182) | 4336182..4336859 | - | 678 | WP_001097301.1 | hypothetical protein | - |
| QBY77_RS21035 (4337007) | 4337007..4337687 | - | 681 | WP_001282919.1 | WYL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | fimB | 4322165..4349413 | 27248 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14072.99 Da Isoelectric Point: 7.3523
>T276889 WP_001094426.1 NZ_CP122448:c4333122-4332745 [Escherichia coli]
MNTLPDTHIREASHCQSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
MNTLPDTHIREASHCQSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13709.52 Da Isoelectric Point: 6.6258
>AT276889 WP_001285575.1 NZ_CP122448:c4333580-4333212 [Escherichia coli]
VSDTLPGTTHPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKRLTCEADTLGSCGYVYMAVYPTPETKK
VSDTLPGTTHPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKRLTCEADTLGSCGYVYMAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A454ABD6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A454ABF5 |