Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4132437..4132987 Replicon chromosome
Accession NZ_CP122448
Organism Escherichia coli strain 85.0412

Toxin (Protein)


Gene name ccdB Uniprot ID S1PDG4
Locus tag QBY77_RS19950 Protein ID WP_001160966.1
Coordinates 4132437..4132751 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID S1NMQ0
Locus tag QBY77_RS19955 Protein ID WP_000125568.1
Coordinates 4132754..4132987 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QBY77_RS19925 (4128112) 4128112..4129398 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
QBY77_RS19930 (4129398) 4129398..4130387 + 990 WP_000241225.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
QBY77_RS19935 (4130384) 4130384..4131205 + 822 WP_001065363.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
QBY77_RS19940 (4131208) 4131208..4131585 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
QBY77_RS19945 (4131592) 4131592..4132440 + 849 WP_000257181.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
QBY77_RS19950 (4132437) 4132437..4132751 - 315 WP_001160966.1 CcdB family protein Toxin
QBY77_RS19955 (4132754) 4132754..4132987 - 234 WP_000125568.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
QBY77_RS19960 (4133073) 4133073..4133552 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
QBY77_RS19965 (4133744) 4133744..4135606 - 1863 WP_000377109.1 glutathione-regulated potassium-efflux system protein KefC -
QBY77_RS19970 (4135599) 4135599..4136129 - 531 WP_000600732.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
QBY77_RS19975 (4136237) 4136237..4137568 - 1332 WP_001183198.1 MFS transporter -
QBY77_RS19980 (4137627) 4137627..4137914 - 288 WP_000203741.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11711.72 Da        Isoelectric Point: 9.0851

>T276883 WP_001160966.1 NZ_CP122448:c4132751-4132437 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8560.55 Da        Isoelectric Point: 5.8062

>AT276883 WP_000125568.1 NZ_CP122448:c4132987-4132754 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENTEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829G815

Antitoxin

Source ID Structure
AlphaFold DB A0A829GEF2

References