Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 2019613..2020444 Replicon chromosome
Accession NZ_CP122448
Organism Escherichia coli strain 85.0412

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag QBY77_RS09685 Protein ID WP_000854814.1
Coordinates 2019613..2019987 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID -
Locus tag QBY77_RS09690 Protein ID WP_024174331.1
Coordinates 2020076..2020444 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QBY77_RS09645 (2015009) 2015009..2016175 + 1167 WP_001297905.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -
QBY77_RS09650 (2016294) 2016294..2016767 + 474 WP_001105376.1 DNA gyrase inhibitor SbmC -
QBY77_RS09655 (2016965) 2016965..2018023 + 1059 WP_001200890.1 FUSC family protein -
QBY77_RS09660 (2018195) 2018195..2018524 + 330 WP_000450409.1 DUF496 family protein -
QBY77_RS09665 (2018625) 2018625..2018948 - 324 WP_223216378.1 EutP/PduV family microcompartment system protein -
QBY77_RS09670 (2018927) 2018927..2019007 + 81 WP_023441679.1 hypothetical protein -
QBY77_RS09675 (2019296) 2019296..2019376 - 81 Protein_1896 hypothetical protein -
QBY77_RS09680 (2019422) 2019422..2019616 - 195 WP_000988601.1 DUF5983 family protein -
QBY77_RS09685 (2019613) 2019613..2019987 - 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QBY77_RS09690 (2020076) 2020076..2020444 - 369 WP_024174331.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QBY77_RS09695 (2020518) 2020518..2020739 - 222 WP_000692346.1 DUF987 domain-containing protein -
QBY77_RS09700 (2020808) 2020808..2021284 - 477 WP_001541535.1 RadC family protein -
QBY77_RS09705 (2021300) 2021300..2021773 - 474 WP_000855074.1 antirestriction protein -
QBY77_RS09710 (2022036) 2022036..2022857 - 822 WP_001234571.1 DUF932 domain-containing protein -
QBY77_RS09715 (2023078) 2023078..2023488 - 411 WP_000846704.1 hypothetical protein -
QBY77_RS09720 (2023504) 2023504..2024181 - 678 WP_001362823.1 hypothetical protein -
QBY77_RS09725 (2024317) 2024317..2025387 - 1071 WP_000102631.1 patatin-like phospholipase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T276872 WP_000854814.1 NZ_CP122448:c2019987-2019613 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13603.42 Da        Isoelectric Point: 6.7386

>AT276872 WP_024174331.1 NZ_CP122448:c2020444-2020076 [Escherichia coli]
VSDTLPGTTHPDDNHDRLWWGLPCTVTPCFGARLVQKGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKT

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure

References