Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 849681..850513 | Replicon | chromosome |
| Accession | NZ_CP122448 | ||
| Organism | Escherichia coli strain 85.0412 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1PD64 |
| Locus tag | QBY77_RS04150 | Protein ID | WP_000854753.1 |
| Coordinates | 849681..850055 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | QBY77_RS04155 | Protein ID | WP_001531802.1 |
| Coordinates | 850145..850513 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QBY77_RS04120 (844796) | 844796..845944 | - | 1149 | WP_000905914.1 | capsule polysaccharide transporter | - |
| QBY77_RS04125 (846016) | 846016..846999 | - | 984 | WP_001335608.1 | KpsF/GutQ family sugar-phosphate isomerase | - |
| QBY77_RS04130 (847809) | 847809..847979 | - | 171 | Protein_812 | IS110 family transposase | - |
| QBY77_RS04135 (848321) | 848321..848890 | - | 570 | WP_001290247.1 | DUF4942 domain-containing protein | - |
| QBY77_RS04140 (848987) | 848987..849184 | - | 198 | WP_000839281.1 | DUF957 domain-containing protein | - |
| QBY77_RS04145 (849196) | 849196..849684 | - | 489 | WP_000777541.1 | DUF5983 family protein | - |
| QBY77_RS04150 (849681) | 849681..850055 | - | 375 | WP_000854753.1 | TA system toxin CbtA family protein | Toxin |
| QBY77_RS04155 (850145) | 850145..850513 | - | 369 | WP_001531802.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QBY77_RS04160 (850676) | 850676..850897 | - | 222 | WP_000692329.1 | DUF987 domain-containing protein | - |
| QBY77_RS04165 (850960) | 850960..851436 | - | 477 | WP_001186726.1 | RadC family protein | - |
| QBY77_RS04170 (851452) | 851452..851937 | - | 486 | WP_001531954.1 | antirestriction protein | - |
| QBY77_RS04175 (851992) | 851992..852813 | - | 822 | WP_001531953.1 | DUF932 domain-containing protein | - |
| QBY77_RS04180 (852992) | 852992..853081 | - | 90 | WP_112031555.1 | DUF905 family protein | - |
| QBY77_RS04185 (853224) | 853224..853679 | - | 456 | WP_000581502.1 | IrmA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 847809..847913 | 104 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14005.00 Da Isoelectric Point: 8.2905
>T276868 WP_000854753.1 NZ_CP122448:c850055-849681 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13422.27 Da Isoelectric Point: 6.3161
>AT276868 WP_001531802.1 NZ_CP122448:c850513-850145 [Escherichia coli]
VSDALSGTMLPDDNHDRPWWGLPCTVTPCFGARLVQEGNSLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
VSDALSGTMLPDDNHDRPWWGLPCTVTPCFGARLVQEGNSLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|