Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 88849..89375 | Replicon | plasmid pI9455333_MCR10 |
| Accession | NZ_CP122443 | ||
| Organism | Enterobacter ludwigii strain I9455333cz | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1EXL1 |
| Locus tag | QCL67_RS26140 | Protein ID | WP_000323025.1 |
| Coordinates | 89088..89375 (+) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | J5W3H0 |
| Locus tag | QCL67_RS26135 | Protein ID | WP_004196370.1 |
| Coordinates | 88849..89088 (+) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QCL67_RS26100 (QCL67_26100) | 84186..84378 | - | 193 | Protein_97 | MFS transporter | - |
| QCL67_RS26105 (QCL67_26105) | 84408..85385 | + | 978 | WP_004196334.1 | chromate resistance protein | - |
| QCL67_RS26110 (QCL67_26110) | 85342..86718 | + | 1377 | Protein_99 | chromate efflux transporter | - |
| QCL67_RS26115 (QCL67_26115) | 86749..87438 | - | 690 | WP_004196322.1 | hypothetical protein | - |
| QCL67_RS26120 (QCL67_26120) | 87452..88189 | - | 738 | WP_008460272.1 | HupE/UreJ family protein | - |
| QCL67_RS26125 (QCL67_26125) | 88233..88598 | - | 366 | WP_009651956.1 | hypothetical protein | - |
| QCL67_RS26130 (QCL67_26130) | 88726..88824 | - | 99 | Protein_103 | protein YdfV | - |
| QCL67_RS26135 (QCL67_26135) | 88849..89088 | + | 240 | WP_004196370.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
| QCL67_RS26140 (QCL67_26140) | 89088..89375 | + | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
| QCL67_RS26145 (QCL67_26145) | 89426..90460 | - | 1035 | Protein_106 | IS481 family transposase | - |
| QCL67_RS26150 (QCL67_26150) | 90532..90693 | + | 162 | WP_023332863.1 | type I toxin-antitoxin system Hok family toxin | - |
| QCL67_RS26155 (QCL67_26155) | 90788..91996 | + | 1209 | WP_015386429.1 | IS256 family transposase | - |
| QCL67_RS26160 (QCL67_26160) | 92278..92409 | - | 132 | WP_255344245.1 | hypothetical protein | - |
| QCL67_RS26165 (QCL67_26165) | 92576..92711 | + | 136 | Protein_110 | single-stranded DNA-binding protein | - |
| QCL67_RS26170 (QCL67_26170) | 92807..93628 | + | 822 | WP_023332864.1 | DUF932 domain-containing protein | - |
| QCL67_RS26175 (QCL67_26175) | 93694..94002 | + | 309 | WP_023332865.1 | DUF5983 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | mcr-10 | mrkA / mrkB / mrkC / mrkF / mrkJ | 1..129863 | 129863 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T276865 WP_000323025.1 NZ_CP122443:89088-89375 [Enterobacter ludwigii]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|