Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 42837..43362 | Replicon | plasmid pI9455333_MCR10 |
| Accession | NZ_CP122443 | ||
| Organism | Enterobacter ludwigii strain I9455333cz | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | D4HQE7 |
| Locus tag | QCL67_RS25865 | Protein ID | WP_013023785.1 |
| Coordinates | 43057..43362 (+) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | W8V2V6 |
| Locus tag | QCL67_RS25860 | Protein ID | WP_001568025.1 |
| Coordinates | 42837..43055 (+) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QCL67_RS25830 (QCL67_25830) | 38616..39032 | - | 417 | WP_000754567.1 | type II toxin-antitoxin system VapC family toxin | - |
| QCL67_RS25835 (QCL67_25835) | 39029..39259 | - | 231 | WP_023293777.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| QCL67_RS25840 (QCL67_25840) | 39535..40035 | + | 501 | WP_021312477.1 | HEPN family nuclease | - |
| QCL67_RS25845 (QCL67_25845) | 40048..40824 | + | 777 | WP_021312478.1 | hypothetical protein | - |
| QCL67_RS25850 (QCL67_25850) | 40986..41234 | + | 249 | WP_023332841.1 | hypothetical protein | - |
| QCL67_RS25855 (QCL67_25855) | 41288..42274 | - | 987 | WP_021312480.1 | hypothetical protein | - |
| QCL67_RS25860 (QCL67_25860) | 42837..43055 | + | 219 | WP_001568025.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| QCL67_RS25865 (QCL67_25865) | 43057..43362 | + | 306 | WP_013023785.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| QCL67_RS25870 (QCL67_25870) | 43549..44553 | + | 1005 | WP_001568027.1 | hypothetical protein | - |
| QCL67_RS25875 (QCL67_25875) | 44737..45516 | + | 780 | WP_001568028.1 | site-specific integrase | - |
| QCL67_RS25880 (QCL67_25880) | 45574..45831 | - | 258 | WP_000764642.1 | hypothetical protein | - |
| QCL67_RS25885 (QCL67_25885) | 45960..46073 | - | 114 | WP_014343462.1 | hypothetical protein | - |
| QCL67_RS25890 (QCL67_25890) | 46704..47459 | + | 756 | WP_001568031.1 | replication initiation protein RepE | - |
| QCL67_RS25895 (QCL67_25895) | 47749..48183 | - | 435 | WP_021312407.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | mcr-10 | mrkA / mrkB / mrkC / mrkF / mrkJ | 1..129863 | 129863 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11615.30 Da Isoelectric Point: 6.4672
>T276864 WP_013023785.1 NZ_CP122443:43057-43362 [Enterobacter ludwigii]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J4ZZW6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J4ZZP8 |