Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 42837..43362 Replicon plasmid pI9455333_MCR10
Accession NZ_CP122443
Organism Enterobacter ludwigii strain I9455333cz

Toxin (Protein)


Gene name ccdB Uniprot ID D4HQE7
Locus tag QCL67_RS25865 Protein ID WP_013023785.1
Coordinates 43057..43362 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID W8V2V6
Locus tag QCL67_RS25860 Protein ID WP_001568025.1
Coordinates 42837..43055 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QCL67_RS25830 (QCL67_25830) 38616..39032 - 417 WP_000754567.1 type II toxin-antitoxin system VapC family toxin -
QCL67_RS25835 (QCL67_25835) 39029..39259 - 231 WP_023293777.1 type II toxin-antitoxin system VapB family antitoxin -
QCL67_RS25840 (QCL67_25840) 39535..40035 + 501 WP_021312477.1 HEPN family nuclease -
QCL67_RS25845 (QCL67_25845) 40048..40824 + 777 WP_021312478.1 hypothetical protein -
QCL67_RS25850 (QCL67_25850) 40986..41234 + 249 WP_023332841.1 hypothetical protein -
QCL67_RS25855 (QCL67_25855) 41288..42274 - 987 WP_021312480.1 hypothetical protein -
QCL67_RS25860 (QCL67_25860) 42837..43055 + 219 WP_001568025.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
QCL67_RS25865 (QCL67_25865) 43057..43362 + 306 WP_013023785.1 type II toxin-antitoxin system toxin CcdB Toxin
QCL67_RS25870 (QCL67_25870) 43549..44553 + 1005 WP_001568027.1 hypothetical protein -
QCL67_RS25875 (QCL67_25875) 44737..45516 + 780 WP_001568028.1 site-specific integrase -
QCL67_RS25880 (QCL67_25880) 45574..45831 - 258 WP_000764642.1 hypothetical protein -
QCL67_RS25885 (QCL67_25885) 45960..46073 - 114 WP_014343462.1 hypothetical protein -
QCL67_RS25890 (QCL67_25890) 46704..47459 + 756 WP_001568031.1 replication initiation protein RepE -
QCL67_RS25895 (QCL67_25895) 47749..48183 - 435 WP_021312407.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid mcr-10 mrkA / mrkB / mrkC / mrkF / mrkJ 1..129863 129863


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11615.30 Da        Isoelectric Point: 6.4672

>T276864 WP_013023785.1 NZ_CP122443:43057-43362 [Enterobacter ludwigii]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8392.34 Da        Isoelectric Point: 4.7405

>AT276864 WP_001568025.1 NZ_CP122443:42837-43055 [Enterobacter ludwigii]
MKQRITVTIDSDSYQLLKSADVNISALVNRAMQNEARRLRSERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2J4ZZW6

Antitoxin

Source ID Structure
AlphaFold DB A0A2J4ZZP8

References