Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 38616..39259 Replicon plasmid pI9455333_MCR10
Accession NZ_CP122443
Organism Enterobacter ludwigii strain I9455333cz

Toxin (Protein)


Gene name vagD Uniprot ID A0A155IU92
Locus tag QCL67_RS25830 Protein ID WP_000754567.1
Coordinates 38616..39032 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID A0A155IUD1
Locus tag QCL67_RS25835 Protein ID WP_023293777.1
Coordinates 39029..39259 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QCL67_RS25795 (QCL67_25795) 33691..34272 + 582 WP_023304048.1 TetR/AcrR family transcriptional regulator -
QCL67_RS25800 (QCL67_25800) 34277..34615 + 339 WP_000888080.1 carboxymuconolactone decarboxylase family protein -
QCL67_RS25805 (QCL67_25805) 34645..34974 - 330 WP_008502229.1 thioredoxin family protein -
QCL67_RS25810 (QCL67_25810) 35187..36293 + 1107 WP_006687059.1 alkene reductase -
QCL67_RS25815 (QCL67_25815) 36359..37060 + 702 WP_008502228.1 DsbA family oxidoreductase -
QCL67_RS25820 (QCL67_25820) 37126..37263 + 138 Protein_41 sugar dehydrogenase -
QCL67_RS25825 (QCL67_25825) 37297..38265 + 969 WP_000654804.1 IS5-like element IS903B family transposase -
QCL67_RS25830 (QCL67_25830) 38616..39032 - 417 WP_000754567.1 type II toxin-antitoxin system VapC family toxin Toxin
QCL67_RS25835 (QCL67_25835) 39029..39259 - 231 WP_023293777.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QCL67_RS25840 (QCL67_25840) 39535..40035 + 501 WP_021312477.1 HEPN family nuclease -
QCL67_RS25845 (QCL67_25845) 40048..40824 + 777 WP_021312478.1 hypothetical protein -
QCL67_RS25850 (QCL67_25850) 40986..41234 + 249 WP_023332841.1 hypothetical protein -
QCL67_RS25855 (QCL67_25855) 41288..42274 - 987 WP_021312480.1 hypothetical protein -
QCL67_RS25860 (QCL67_25860) 42837..43055 + 219 WP_001568025.1 type II toxin-antitoxin system antitoxin CcdA -
QCL67_RS25865 (QCL67_25865) 43057..43362 + 306 WP_013023785.1 type II toxin-antitoxin system toxin CcdB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid mcr-10 mrkA / mrkB / mrkC / mrkF / mrkJ 1..129863 129863


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15108.61 Da        Isoelectric Point: 8.5403

>T276863 WP_000754567.1 NZ_CP122443:c39032-38616 [Enterobacter ludwigii]
MKKTWMLDTNICSFIMREQPAAVLKRLEQVVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPGLVLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8706.73 Da        Isoelectric Point: 4.4299

>AT276863 WP_023293777.1 NZ_CP122443:c39259-39029 [Enterobacter ludwigii]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRADPDFMAQREDVVSDEGRFDP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A155IU92

Antitoxin

Source ID Structure
AlphaFold DB A0A155IUD1

References