Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeV-yfjZ/CbtA-CbeA |
| Location | 5077467..5078189 | Replicon | chromosome |
| Accession | NZ_CP122442 | ||
| Organism | Enterobacter ludwigii strain I9455333cz | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | QCL67_RS24795 | Protein ID | WP_085119314.1 |
| Coordinates | 5077869..5078189 (+) | Length | 107 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | - |
| Locus tag | QCL67_RS24790 | Protein ID | WP_085119315.1 |
| Coordinates | 5077467..5077802 (+) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QCL67_RS24775 (QCL67_24775) | 5073528..5075261 | + | 1734 | WP_085119320.1 | ATP-binding protein | - |
| QCL67_RS24780 (QCL67_24780) | 5075593..5076492 | - | 900 | WP_085119318.1 | SMEK domain-containing protein | - |
| QCL67_RS24785 (QCL67_24785) | 5076974..5077453 | + | 480 | WP_085119317.1 | DNA repair protein RadC | - |
| QCL67_RS24790 (QCL67_24790) | 5077467..5077802 | + | 336 | WP_085119315.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QCL67_RS24795 (QCL67_24795) | 5077869..5078189 | + | 321 | WP_085119314.1 | TA system toxin CbtA family protein | Toxin |
| QCL67_RS24800 (QCL67_24800) | 5078303..5079136 | + | 834 | WP_085119312.1 | DUF4942 domain-containing protein | - |
| QCL67_RS24810 (QCL67_24810) | 5079439..5079945 | + | 507 | WP_025202984.1 | G/U mismatch-specific DNA glycosylase | - |
| QCL67_RS24815 (QCL67_24815) | 5080030..5081877 | - | 1848 | WP_020883616.1 | RNA polymerase sigma factor RpoD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 5049515..5079945 | 30430 | |
| - | flank | IS/Tn | - | - | 5072269..5073249 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 12118.67 Da Isoelectric Point: 5.0486
>T276862 WP_085119314.1 NZ_CP122442:5077869-5078189 [Enterobacter ludwigii]
MQTTTVPATLPVSSRLSPVQVWQQLLTYLLEHHYGLTLNDTPFHDDASIEEHIEAGITLADAVNFLVERYELVRTDRKGF
TWQEQTPFLTATDFLRARRATGLMNT
MQTTTVPATLPVSSRLSPVQVWQQLLTYLLEHHYGLTLNDTPFHDDASIEEHIEAGITLADAVNFLVERYELVRTDRKGF
TWQEQTPFLTATDFLRARRATGLMNT
Download Length: 321 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|