Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3221423..3222043 | Replicon | chromosome |
| Accession | NZ_CP122442 | ||
| Organism | Enterobacter ludwigii strain I9455333cz | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | G8LPY2 |
| Locus tag | QCL67_RS15800 | Protein ID | WP_014168902.1 |
| Coordinates | 3221825..3222043 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | W0BRV6 |
| Locus tag | QCL67_RS15795 | Protein ID | WP_020885187.1 |
| Coordinates | 3221423..3221797 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QCL67_RS15785 (QCL67_15785) | 3216549..3217742 | + | 1194 | WP_020885186.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| QCL67_RS15790 (QCL67_15790) | 3217765..3220911 | + | 3147 | WP_014168904.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| QCL67_RS15795 (QCL67_15795) | 3221423..3221797 | + | 375 | WP_020885187.1 | Hha toxicity modulator TomB | Antitoxin |
| QCL67_RS15800 (QCL67_15800) | 3221825..3222043 | + | 219 | WP_014168902.1 | HHA domain-containing protein | Toxin |
| QCL67_RS15805 (QCL67_15805) | 3222253..3222804 | + | 552 | WP_020885188.1 | maltose O-acetyltransferase | - |
| QCL67_RS15810 (QCL67_15810) | 3222922..3223389 | + | 468 | WP_279795482.1 | YlaC family protein | - |
| QCL67_RS15815 (QCL67_15815) | 3223361..3224821 | - | 1461 | WP_040016798.1 | PLP-dependent aminotransferase family protein | - |
| QCL67_RS15820 (QCL67_15820) | 3224922..3225632 | + | 711 | WP_014168897.1 | GNAT family protein | - |
| QCL67_RS15825 (QCL67_15825) | 3225629..3225769 | - | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
| QCL67_RS15830 (QCL67_15830) | 3225772..3226032 | - | 261 | WP_010428154.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8654.04 Da Isoelectric Point: 8.9107
>T276860 WP_014168902.1 NZ_CP122442:3221825-3222043 [Enterobacter ludwigii]
MSEKPLTKIDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWRFVR
MSEKPLTKIDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWRFVR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14495.31 Da Isoelectric Point: 4.8886
>AT276860 WP_020885187.1 NZ_CP122442:3221423-3221797 [Enterobacter ludwigii]
MDEYSPKRHDIAQLKFLCESLYHDCLANLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFINVSRANPVSLSC
MDEYSPKRHDIAQLKFLCESLYHDCLANLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFINVSRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A839BM33 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5C1BX74 |