Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 100829..101486 | Replicon | chromosome |
| Accession | NZ_CP122442 | ||
| Organism | Enterobacter ludwigii strain I9455333cz | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | G8LDB6 |
| Locus tag | QCL67_RS00515 | Protein ID | WP_014171514.1 |
| Coordinates | 101076..101486 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | G8LDB7 |
| Locus tag | QCL67_RS00510 | Protein ID | WP_003863437.1 |
| Coordinates | 100829..101095 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QCL67_RS00490 (QCL67_00490) | 96238..97671 | - | 1434 | WP_025203279.1 | 6-phospho-beta-glucosidase BglA | - |
| QCL67_RS00495 (QCL67_00495) | 97788..98519 | - | 732 | WP_020883729.1 | MurR/RpiR family transcriptional regulator | - |
| QCL67_RS00500 (QCL67_00500) | 98786..99445 | + | 660 | WP_014171517.1 | hemolysin III family protein | - |
| QCL67_RS00505 (QCL67_00505) | 99554..100534 | - | 981 | WP_020883730.1 | tRNA-modifying protein YgfZ | - |
| QCL67_RS00510 (QCL67_00510) | 100829..101095 | + | 267 | WP_003863437.1 | FAD assembly factor SdhE | Antitoxin |
| QCL67_RS00515 (QCL67_00515) | 101076..101486 | + | 411 | WP_014171514.1 | protein YgfX | Toxin |
| QCL67_RS00520 (QCL67_00520) | 101493..102014 | - | 522 | WP_014171513.1 | flavodoxin FldB | - |
| QCL67_RS00525 (QCL67_00525) | 102116..103012 | + | 897 | WP_014171511.1 | site-specific tyrosine recombinase XerD | - |
| QCL67_RS00530 (QCL67_00530) | 103036..103749 | + | 714 | WP_020883731.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| QCL67_RS00535 (QCL67_00535) | 103755..105488 | + | 1734 | WP_113656427.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16217.15 Da Isoelectric Point: 11.5020
>T276853 WP_014171514.1 NZ_CP122442:101076-101486 [Enterobacter ludwigii]
VVLWQSDLRVSWRSQWMSLLLHGLVAAFVLLMPWPLSYTPLWLLLLSFVVFDSVRSQRRIHARQGEIKLLMDSRLRWQGK
EWEILGMPWMIASGMMLRLRSVDSGRRQHLWLAADSMDSAEWRDLRRMLLQQLTQE
VVLWQSDLRVSWRSQWMSLLLHGLVAAFVLLMPWPLSYTPLWLLLLSFVVFDSVRSQRRIHARQGEIKLLMDSRLRWQGK
EWEILGMPWMIASGMMLRLRSVDSGRRQHLWLAADSMDSAEWRDLRRMLLQQLTQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A839BUV6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A837F8P5 |