Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-StbC |
| Location | 5588288..5588955 | Replicon | chromosome |
| Accession | NZ_CP122407 | ||
| Organism | Rugamonas sp. DEMB1 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | QC826_RS25780 | Protein ID | WP_279763028.1 |
| Coordinates | 5588539..5588955 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | QC826_RS25775 | Protein ID | WP_279763027.1 |
| Coordinates | 5588288..5588542 (+) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QC826_RS25750 (QC826_25750) | 5583381..5584958 | - | 1578 | WP_279763023.1 | carboxylesterase family protein | - |
| QC826_RS25755 (QC826_25755) | 5585241..5586140 | + | 900 | WP_279763024.1 | LytTR family DNA-binding domain-containing protein | - |
| QC826_RS25765 (QC826_25765) | 5587001..5587201 | + | 201 | WP_279763025.1 | hypothetical protein | - |
| QC826_RS25770 (QC826_25770) | 5587384..5587809 | - | 426 | WP_279763026.1 | SRPBCC family protein | - |
| QC826_RS25775 (QC826_25775) | 5588288..5588542 | + | 255 | WP_279763027.1 | plasmid stabilization protein | Antitoxin |
| QC826_RS25780 (QC826_25780) | 5588539..5588955 | + | 417 | WP_279763028.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QC826_RS25785 (QC826_25785) | 5589150..5589965 | + | 816 | WP_279763029.1 | small-conductance mechanosensitive ion channel | - |
| QC826_RS25790 (QC826_25790) | 5590084..5590410 | - | 327 | WP_279763030.1 | helix-turn-helix domain-containing protein | - |
| QC826_RS25795 (QC826_25795) | 5590568..5591197 | + | 630 | WP_279763031.1 | glutathione transferase GstA | - |
| QC826_RS25800 (QC826_25800) | 5591304..5591840 | - | 537 | WP_279763032.1 | DUF2058 domain-containing protein | - |
| QC826_RS25805 (QC826_25805) | 5592139..5592852 | + | 714 | WP_279763033.1 | PEP-CTERM sorting domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 14987.38 Da Isoelectric Point: 9.8612
>T276852 WP_279763028.1 NZ_CP122407:5588539-5588955 [Rugamonas sp. DEMB1]
MIVLDTNVVSEAMKPEPHPAVRAWLNKQVAETLYLSSVTLAELLFGIRALPAGKRKDTLARTLDGLMVPFRDRVLPFDVD
AARHYADLAVAAKVAGRGFPTPDGYIAAIAVSRRFIVASRDTAPYQAAGVTVINPWQS
MIVLDTNVVSEAMKPEPHPAVRAWLNKQVAETLYLSSVTLAELLFGIRALPAGKRKDTLARTLDGLMVPFRDRVLPFDVD
AARHYADLAVAAKVAGRGFPTPDGYIAAIAVSRRFIVASRDTAPYQAAGVTVINPWQS
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|